BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31819 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 2.6 AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 23 4.6 AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding pr... 23 6.1 AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding pr... 23 8.1 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 24.2 bits (50), Expect = 2.6 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = -2 Query: 428 YLNFCTPYFHTFFSRMQSLPDDYRCCPCRSTTRFLRCCS 312 YL CT F R +PD + C + T R CS Sbjct: 163 YLYNCTDQQLAEFKRANIIPDTAKSCGLITRTNAERLCS 201 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 23.4 bits (48), Expect = 4.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 348 RTAPIVIRQALHSGEEXVKIW 410 R I I ALH E VKIW Sbjct: 80 RARRIEIANALHLNETQVKIW 100 >AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding protein protein. Length = 157 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 370 GKLCILEKXV*KYGVQKFK*CQ*LQESGALEC 465 GKLC+ E V V++F ++ AL+C Sbjct: 54 GKLCLEETGVSPEAVKRFSDADPFDDNRALKC 85 >AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding protein AgamOBP2 protein. Length = 159 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 370 GKLCILEKXV*KYGVQKFK*CQ*LQESGALEC 465 GKLC+ E V +++F ++ AL+C Sbjct: 54 GKLCLEETGVSPEAIKRFSDADPFDDNRALKC 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,430 Number of Sequences: 2352 Number of extensions: 9316 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -