BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31819 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49068-2|CAA88855.1| 389|Caenorhabditis elegans Hypothetical pr... 28 3.4 Z81537-3|CAB04374.1| 348|Caenorhabditis elegans Hypothetical pr... 27 6.0 >Z49068-2|CAA88855.1| 389|Caenorhabditis elegans Hypothetical protein K01C8.2 protein. Length = 389 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 377 SLPDDYRCCPCRSTTRFLRCCSISKLIC 294 S P Y C P ++FL C S LIC Sbjct: 318 SCPIGYSCAPSNQVSQFLCCRLASSLIC 345 >Z81537-3|CAB04374.1| 348|Caenorhabditis elegans Hypothetical protein F41D3.3 protein. Length = 348 Score = 27.5 bits (58), Expect = 6.0 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 5/72 (6%) Frame = -2 Query: 452 PDSCNY*HYLNFCTPYFHTFFSRMQSLPDDYRC-----CPCRSTTRFLRCCSISKLICGV 288 P S Y H+ C P +FF R SL Y C C S + C + C + Sbjct: 16 PCSMRYSHFGGICCPACASFFRRTVSLNIRYLCKKQNNCSGISKKYHIVCRACRYEKC-I 74 Query: 287 KEATSRRIIIPH 252 K+A +R ++ H Sbjct: 75 KKAGMKRSLVQH 86 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,078,372 Number of Sequences: 27780 Number of extensions: 212167 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -