BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31819 (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 24 0.81 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 7.5 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 24.2 bits (50), Expect = 0.81 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 404 FHTFFSRMQSLPDDYRCCPCRSTTR 330 FHT QSL +CCP + T+ Sbjct: 794 FHTDIGNSQSLAHQDQCCPGFTMTK 818 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.0 bits (42), Expect = 7.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 20 GYKLLKQNKSSSFGR*NM*T*WLVPY*LEKSRNKNQN 130 G K++KQ S+ + R N W+V +K N + N Sbjct: 353 GIKIIKQISSNIYERQNNEYIWIVSNKYQKIANGDLN 389 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,107 Number of Sequences: 438 Number of extensions: 2264 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -