BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31816 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 22 3.7 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 22 3.7 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 3.7 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 3.7 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 377 RSFAFLSPANTILVPGMY 324 R FA P NT L G Y Sbjct: 266 RGFALADPTNTSLYAGTY 283 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 368 QMSVLTLLPISNLLPSNFKVIENSIRSIFHNISGIYFLFS 487 ++S + L+ ++ L + NS+R + +N+ IYF +S Sbjct: 286 EISYIVLMSFASDLLFILIQLFNSLRQMKNNLERIYFYWS 325 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 368 QMSVLTLLPISNLLPSNFKVIENSIRSIFHNISGIYFLFS 487 ++S + L+ ++ L + NS+R + +N+ IYF +S Sbjct: 286 EISYIVLMSFASDLLFILIQLFNSLRQMKNNLERIYFYWS 325 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 368 QMSVLTLLPISNLLPSNFKVIENSIRSIFHNISGIYFLFS 487 ++S + L+ ++ L + NS+R + +N+ IYF +S Sbjct: 286 EISYIVLMSFASDLLFILIQLFNSLRQMKNNLERIYFYWS 325 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,229 Number of Sequences: 336 Number of extensions: 3106 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -