BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31814 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyc... 27 1.7 SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 8.9 >SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 27.1 bits (57), Expect = 1.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 303 LKSMGDGNHSPSSGSYARQYARTRKNKLSA 214 +K+ GDG GS+ RQ A T+ N LS+ Sbjct: 254 IKNAGDGLRLLREGSHRRQVAATKCNDLSS 283 >SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 871 Score = 24.6 bits (51), Expect = 8.9 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 3 VPCVLYWKYVYLALREVYSYSELCVVNE*LNQNKIMQELTSQVVAMKCRSPSQAAARLIS 182 V C LY+KY +L L + S + V+E + K +L + + R+ + +L S Sbjct: 667 VACHLYFKYKFLPLMDAVPISAIESVSE-RPEIKYPMDLGTSEMKNVGRAYPEILEKLSS 725 Query: 183 ES-IDDYISRHKRT 221 S D+++ RT Sbjct: 726 SSGSDEFLETSSRT 739 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,967,032 Number of Sequences: 5004 Number of extensions: 36097 Number of successful extensions: 90 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -