BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31814 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003140-4|AAD47119.1| 2712|Caenorhabditis elegans Hypothetical ... 29 1.5 AF003140-3|AAM15563.1| 2710|Caenorhabditis elegans Hypothetical ... 29 1.5 Z78418-3|CAB01697.1| 932|Caenorhabditis elegans Hypothetical pr... 28 4.6 >AF003140-4|AAD47119.1| 2712|Caenorhabditis elegans Hypothetical protein C44E4.1a protein. Length = 2712 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/56 (19%), Positives = 32/56 (57%) Frame = +3 Query: 102 KIMQELTSQVVAMKCRSPSQAAARLISESIDDYISRHKRTVYFFLSLHTDEHTTHL 269 ++M+ ++ +C+ +QA +++ + + + ++ ++ FL++ TD+ T HL Sbjct: 563 ELMRNEMKRMPLHRCQMMAQAIVKIVFGLLSNGTNEAEQLIHVFLNIFTDQDTYHL 618 >AF003140-3|AAM15563.1| 2710|Caenorhabditis elegans Hypothetical protein C44E4.1c protein. Length = 2710 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/56 (19%), Positives = 32/56 (57%) Frame = +3 Query: 102 KIMQELTSQVVAMKCRSPSQAAARLISESIDDYISRHKRTVYFFLSLHTDEHTTHL 269 ++M+ ++ +C+ +QA +++ + + + ++ ++ FL++ TD+ T HL Sbjct: 563 ELMRNEMKRMPLHRCQMMAQAIVKIVFGLLSNGTNEAEQLIHVFLNIFTDQDTYHL 618 >Z78418-3|CAB01697.1| 932|Caenorhabditis elegans Hypothetical protein F25D7.4 protein. Length = 932 Score = 27.9 bits (59), Expect = 4.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 360 SRSLVNRRRTSHSPRVTVPARADPAKRTP 446 +RS RT+ PR T P +A PA + P Sbjct: 339 TRSATPATRTAVPPRATAPPKAAPASKAP 367 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,011,509 Number of Sequences: 27780 Number of extensions: 205209 Number of successful extensions: 627 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -