BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31813 (391 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharom... 25 4.1 SPAC8C9.19 |||conserved fungal protein|Schizosaccharomyces pombe... 24 7.2 >SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 1462 Score = 25.0 bits (52), Expect = 4.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 139 FLK*IKSPVFSSCSH*LCLSYITCIFAFLVV 47 FL+ IKSP + LCLS I F+F ++ Sbjct: 109 FLRTIKSPRMTGYITSLCLSAILKFFSFRII 139 >SPAC8C9.19 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 94 Score = 24.2 bits (50), Expect = 7.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 133 K*IKSPVFSSCSH*LCLSYITC 68 K I SPV SS H L +SY C Sbjct: 46 KVISSPVVSSPIHALSMSYFEC 67 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,102,938 Number of Sequences: 5004 Number of extensions: 15890 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 128029482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -