BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31812 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17205.1 68416.m02196 HECT-domain-containing protein / ubiqui... 29 1.9 At1g45130.1 68414.m05173 beta-galactosidase, putative / lactase,... 28 4.3 At2g29680.2 68415.m03608 cell division control protein CDC6, put... 27 9.9 At2g29680.1 68415.m03607 cell division control protein CDC6, put... 27 9.9 >At3g17205.1 68416.m02196 HECT-domain-containing protein / ubiquitin-transferase family protein weak similarity to ubiquitin-protein ligase 2 [Arabidopsis thaliana] GI:7108523; contains Pfam profile PF00632: HECT-domain (ubiquitin-transferase) Length = 873 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/60 (25%), Positives = 28/60 (46%) Frame = +1 Query: 46 LKSNNYDNINIVIGNESCDLDSAVCSIVYALYLNWQHNQIKCKVCTKDKRGASSKDDIFV 225 L N D N+V+ C LD A+ + A + +K + ++G+S +DD+ + Sbjct: 165 LLGNTLDTANVVLSQPECSLDMAIDIALVATFFLETLPPVKSSE-GESRQGSSDEDDMLI 223 >At1g45130.1 68414.m05173 beta-galactosidase, putative / lactase, putative similar to beta-galactosidase [Lycopersicon esculentum] GI:7939619, beta-galactosidase BG1 GI:15081596 from [Vitis vinifera]; contains Pfam profile PF01301: Glycosyl hydrolases family 35 Length = 732 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -2 Query: 80 TILMLS*LLDFNLFTMLFKNSFIVCS 3 TIL+LS +L F L TML +S I CS Sbjct: 4 TILVLSKILTFLLTTMLIGSSVIQCS 29 >At2g29680.2 68415.m03608 cell division control protein CDC6, putative almost identical to DNA replication protein CDC6 GI:18056480 from [Arabidopsis thaliana]; identical to cDNA CDC6 protein (2g29680 gene) GI:18056479 Length = 508 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 361 KCNVVLVDHHVLAANDVFLSPFVSEI 438 +C VV +DH + A + F SP V I Sbjct: 382 ECQVVKMDHMIAALSKTFKSPIVDTI 407 >At2g29680.1 68415.m03607 cell division control protein CDC6, putative almost identical to DNA replication protein CDC6 GI:18056480 from [Arabidopsis thaliana]; identical to cDNA CDC6 protein (2g29680 gene) GI:18056479 Length = 539 Score = 26.6 bits (56), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 361 KCNVVLVDHHVLAANDVFLSPFVSEI 438 +C VV +DH + A + F SP V I Sbjct: 413 ECQVVKMDHMIAALSKTFKSPIVDTI 438 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,486,148 Number of Sequences: 28952 Number of extensions: 206733 Number of successful extensions: 569 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -