BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31805 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015241-1|AAT94470.1| 257|Drosophila melanogaster RE01054p pro... 28 8.6 AE014297-437|AAF54139.1| 266|Drosophila melanogaster CG15189-PA... 28 8.6 >BT015241-1|AAT94470.1| 257|Drosophila melanogaster RE01054p protein. Length = 257 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = -2 Query: 425 KISYFSTYSIKFFLRIQSINLSFVYFSIQI*ELVVYHHH*SMHNVVACPWHG 270 KI F+ ++ FF I S+ L+ Q+ + + + HH + H PW G Sbjct: 183 KIKAFNALALGFFSFIVSVGLAI----FQLCKKIAHDHHHTAHITAHGPWDG 230 >AE014297-437|AAF54139.1| 266|Drosophila melanogaster CG15189-PA protein. Length = 266 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = -2 Query: 425 KISYFSTYSIKFFLRIQSINLSFVYFSIQI*ELVVYHHH*SMHNVVACPWHG 270 KI F+ ++ FF I S+ L+ Q+ + + + HH + H PW G Sbjct: 192 KIKAFNALALGFFSFIVSVGLAI----FQLCKKIAHDHHHTAHITAHGPWDG 239 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,219,448 Number of Sequences: 53049 Number of extensions: 246952 Number of successful extensions: 662 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -