BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31804 (516 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2221|AAN11842.1| 393|Drosophila melanogaster CG33264-P... 29 2.8 AE014296-2220|AAF49864.3| 393|Drosophila melanogaster CG33264-P... 29 2.8 >AE014296-2221|AAN11842.1| 393|Drosophila melanogaster CG33264-PB, isoform B protein. Length = 393 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 141 NYYKPTLIYLKCLKI*LENATKLYYHKTFKI 233 N+Y+ L+Y + L I + ATK Y KT+K+ Sbjct: 337 NWYEGDLVYRRMLLILMMRATKPYMWKTYKL 367 >AE014296-2220|AAF49864.3| 393|Drosophila melanogaster CG33264-PA, isoform A protein. Length = 393 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 141 NYYKPTLIYLKCLKI*LENATKLYYHKTFKI 233 N+Y+ L+Y + L I + ATK Y KT+K+ Sbjct: 337 NWYEGDLVYRRMLLILMMRATKPYMWKTYKL 367 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,366,442 Number of Sequences: 53049 Number of extensions: 250414 Number of successful extensions: 289 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 289 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1887744768 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -