BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31803 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1044 - 8208126-8208230,8208468-8208536,8208640-8208711 44 6e-05 02_03_0412 - 18749430-18749587,18749696-18749857,18750062-187501... 27 6.8 02_03_0199 + 16263549-16263644,16264941-16265899,16267140-162677... 27 6.8 10_08_0825 + 20831170-20831349,20831380-20831547,20831627-208316... 27 8.9 >06_01_1044 - 8208126-8208230,8208468-8208536,8208640-8208711 Length = 81 Score = 44.4 bits (100), Expect = 6e-05 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +2 Query: 215 MTFVPNWEEFEKAAEMLYLQDPINTRYSVKYSHSKGAFNVKITDNKKCLQY 367 M + +W+EF + L+ P TRY VKY H +G +K+TDN + + + Sbjct: 1 MVYFDSWDEFVSKSVELFRNHPDTTRYVVKYRHCEGKLVLKVTDNHENIHW 51 >02_03_0412 - 18749430-18749587,18749696-18749857,18750062-18750194, 18751640-18751744,18751818-18751935,18752232-18752320, 18752407-18753660,18753785-18753831,18754285-18754339, 18754783-18754884 Length = 740 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -2 Query: 314 NVNI*HCTEYLLDPVDITFPRLSQTLPNLEQKSLRPIIDYSLEMFLK 174 +VN + + DP+ PR +T P Q+ +RP Y+ ++FL+ Sbjct: 147 SVNANYLLNFHYDPISRPQPRGPRTYPTRRQRKIRP---YNKDLFLQ 190 >02_03_0199 + 16263549-16263644,16264941-16265899,16267140-16267791, 16267895-16267981,16268253-16268381,16269990-16270036, 16271337-16271438,16272720-16272843,16272981-16273028, 16273934-16274026,16274325-16274408,16274536-16274619, 16274751-16274819,16275531-16275590,16275946-16276017, 16276957-16277064,16278162-16278238,16278391-16278474, 16278617-16278728,16278778-16278810,16278811-16278900, 16279012-16279077,16279163-16279258,16279446-16279497, 16279723-16279775,16279998-16280018 Length = 1165 Score = 27.5 bits (58), Expect = 6.8 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 278 DPVDITF-PRLSQTLPNLEQKSLRPIIDYSLEMFLKIVP 165 D + TF PRL LP+ ++K++ I+ L++FLK P Sbjct: 1009 DEIQSTFTPRLLGVLPDSDEKNVYDILLLVLQVFLKQGP 1047 >10_08_0825 + 20831170-20831349,20831380-20831547,20831627-20831698, 20831997-20832075,20832182-20832375,20832469-20832558, 20832851-20832940,20833196-20833282,20833477-20833560, 20833690-20833809,20834096-20834103,20834443-20834575, 20835044-20835125,20835330-20835496,20836006-20836493, 20836551-20836638,20836716-20836818,20836932-20837083, 20837191-20837316,20837459-20837529,20837691-20837753, 20838418-20838490,20838972-20839040,20839180-20839257, 20839434-20839484,20839586-20839696 Length = 1008 Score = 27.1 bits (57), Expect = 8.9 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 6/52 (11%) Frame = +2 Query: 335 KITDNK----KCLQYKTEVQQDVRKIDKFMSNLLRHMASNDN*I--NVIINL 472 +ITDNK K +Q E++QD++ + N RH++S+ N + ++++N+ Sbjct: 201 QITDNKFWPVKGMQLVMELEQDLKVANVICMNGRRHVSSSKNEVSRDLVVNV 252 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,544,751 Number of Sequences: 37544 Number of extensions: 200275 Number of successful extensions: 339 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 339 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -