BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31798 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 26 0.17 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 26 0.17 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 23 2.1 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 2.1 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 4.9 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 8.6 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 26.2 bits (55), Expect = 0.17 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 312 FVKITYVMYLTKLASAWLKCQRTPNCTQSCWSHLLC 419 + T +Y T L +A C TPN T + WSH C Sbjct: 122 YYHFTLELY-TVLGAACQVC--TPNATNTVWSHCQC 154 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 26.2 bits (55), Expect = 0.17 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +3 Query: 312 FVKITYVMYLTKLASAWLKCQRTPNCTQSCWSHLLC 419 + T +Y T L +A C TPN T + WSH C Sbjct: 122 YYHFTLELY-TVLGAACQVC--TPNATNTVWSHCQC 154 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 22.6 bits (46), Expect = 2.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 332 YVRDLHELSVPSDELGSACSKIGSSSEVQPASPS 231 Y DL S+ EL + GSS QPA+ S Sbjct: 223 YYGDLDLKSIRKSELLAGLQSSGSSRSHQPATKS 256 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 2.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 344 EARKRLAEVPKDTKLYSELLVTLI 415 +A K L PK K+YS LL+T + Sbjct: 11 DALKILGIGPKSNKIYSFLLLTTL 34 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 155 PSHRFLRPF 129 P HRFL PF Sbjct: 376 PDHRFLEPF 384 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.6 bits (41), Expect = 8.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 439 GTHCHHPRPSNRQGSGGVP 495 G H PS G+GG+P Sbjct: 255 GLHATGSAPSPTAGAGGLP 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,958 Number of Sequences: 336 Number of extensions: 1871 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -