BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31792 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizos... 25 5.1 SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr... 25 6.7 >SPBC21D10.05c |ucp3|soc2|GTPase activating protein Ucp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 25.4 bits (53), Expect = 5.1 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -1 Query: 381 YGNLVTTFTSSK*SSLVXFPTTPTAVKPPRVGPKTSLNHSIGS 253 YG +T+S SS+V P P P + + N+S+ S Sbjct: 321 YGIDSNLYTNSNSSSIVQNPLQPARTGPAAINYNYTTNYSVSS 363 >SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 593 Score = 25.0 bits (52), Expect = 6.7 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 192 LLGIPRLWGIIANPNPQHEGVSAGCPGL*ARENM 91 L G+P ++G++ P EG++ G EN+ Sbjct: 292 LYGVPSMYGVVTLPYSVREGINIFLDGHIPTENL 325 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,044,142 Number of Sequences: 5004 Number of extensions: 40488 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -