BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31790 (397 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 30 0.035 AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein pro... 22 7.1 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 29.9 bits (64), Expect = 0.035 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +3 Query: 186 YETSNGIKAQETGQLKNIGTENEALEVRGEFAYIGPDGVTYAVTYVAN 329 YE S + + TG +KN EV G+++ + DG V Y A+ Sbjct: 84 YEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHAD 131 >AF457546-1|AAL68776.1| 182|Anopheles gambiae 30 kDa protein protein. Length = 182 Score = 22.2 bits (45), Expect = 7.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 135 DDSVGNRADWGSDSYGDEESDNEE 64 DD+V D +S D E D+EE Sbjct: 118 DDAVSGADDETEESKDDAEEDSEE 141 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.310 0.124 0.349 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 320,332 Number of Sequences: 2352 Number of extensions: 5093 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31212099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -