BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31787 (484 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containi... 31 0.41 At3g10150.1 68416.m01217 calcineurin-like phosphoesterase family... 29 1.2 At5g27230.1 68418.m03248 expressed protein ; expression support... 29 1.6 At3g24440.1 68416.m03067 fibronectin type III domain-containing ... 29 2.2 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 28 2.9 At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 28 2.9 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 28 2.9 At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 28 3.8 At2g39290.1 68415.m04824 phosphatidylglycerolphosphate synthase ... 27 5.0 At3g20260.1 68416.m02566 expressed protein 27 6.6 At4g23930.2 68417.m03442 expressed protein hin1 protein homolog,... 27 8.8 At4g22320.1 68417.m03227 expressed protein 27 8.8 At3g20610.1 68416.m02608 non-race specific disease resistance pr... 27 8.8 >At5g46580.1 68418.m05735 pentatricopeptide (PPR) repeat-containing protein contains similarity to 67kD chloroplastic RNA-binding protein, P67.1 [Raphanus sativus] GI:9755886; contains Pfam profile PF01535: PPR repeat Length = 711 Score = 31.1 bits (67), Expect = 0.41 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 212 KAVEEFLKMYRTGFMPKNLEFSVFYD 289 KA+E F +MY+TG MP + +S D Sbjct: 239 KAIEWFERMYKTGLMPDEVTYSAILD 264 >At3g10150.1 68416.m01217 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 367 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 133 LAHILEEGQNFLLLF--NKYGIHIFCLYGARLWYCTAEHDGY 14 + +LE + +F + +G+ C Y +LW C A H GY Sbjct: 284 MMRVLENRSSVKAVFVGHNHGLDWCCPYKDKLWLCFARHTGY 325 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 29.1 bits (62), Expect = 1.6 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +2 Query: 71 VDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLK 235 V A+ +EK++K L D S E+ K KD+D+E + K+ VE+ K Sbjct: 69 VKALELEKKEKELCLI-DESMKAKQSEFEKKEKDFDLEQKAEVEKRKREVEQLEK 122 >At3g24440.1 68416.m03067 fibronectin type III domain-containing protein contains Pfam profile PF00041: Fibronectin type III domain Length = 602 Score = 28.7 bits (61), Expect = 2.2 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 1 SGWACSRRAQQCSTKAEHHKDKKCGCRIC*KAKENS--VLLPRCEPTK 138 S W C + + + E K+C C +C EN L CEP K Sbjct: 45 SSWICKNASCRANVPKEDSFCKRCSCCVCHNFDENKDPSLWLVCEPEK 92 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.3 bits (60), Expect = 2.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 137 NTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFL 232 N +DEY K DYD + +D T K+A + L Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDIL 573 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 28.3 bits (60), Expect = 2.9 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 469 RSRNNETVAIRALDTXDVEGXQELTLIEMHTRKTGSLVERFKVLS 335 R + + AL DVE +E+ L+E T G ER+ VLS Sbjct: 836 RKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 28.3 bits (60), Expect = 2.9 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 469 RSRNNETVAIRALDTXDVEGXQELTLIEMHTRKTGSLVERFKVLS 335 R + + AL DVE +E+ L+E T G ER+ VLS Sbjct: 836 RKDDGRNKRMEALKNNDVERYREM-LLEQQTNMPGDAAERYAVLS 879 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 27.9 bits (59), Expect = 3.8 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +2 Query: 89 EKQKKILSFFQD--VSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFMPK 262 EK +K+L+ Q + QL D+ K+G Y E +DN ++ + + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 263 NLEFSVF 283 LEF +F Sbjct: 142 ALEFRLF 148 >At2g39290.1 68415.m04824 phosphatidylglycerolphosphate synthase (PGS1) identical to phosphatidylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana] Length = 296 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 143 QCLVGSHLGRRTEFSFAFQQIRHPHFLSLWCSA 45 +C++ S RT F Q RH H LS + S+ Sbjct: 33 RCIITSRYSSRTSLRFPIQISRHQHRLSYFSSS 65 >At3g20260.1 68416.m02566 expressed protein Length = 437 Score = 27.1 bits (57), Expect = 6.6 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +2 Query: 89 EKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFM 256 EK+ KIL+ + NT+ GK +IE + D++ + ++ R FM Sbjct: 20 EKEDKILAQQEQARSENTEAGVIDSGKGDEIEDDDDDFITNEVKRRLKELRRNSFM 75 >At4g23930.2 68417.m03442 expressed protein hin1 protein homolog, Oryza sativa, PIR:T02662 Length = 160 Score = 26.6 bits (56), Expect = 8.8 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 230 LKMYRTGFMPKNLEFSVFYDKMRDEAIALFHLFYY 334 L +Y T F P++ E SV K+ ++A LFYY Sbjct: 26 LTVYLTVFRPRDPEISVTSVKVPSFSVANSSLFYY 60 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 26.6 bits (56), Expect = 8.8 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +2 Query: 47 PSTIKTKNVDAVFVEKQKKILSFFQDVSQLNTDDEYYKIGKDYDIEMNMDNYTNKKAVEE 226 P + K V +E+QKK ++ ++ ++ DD KI +D +E D K VEE Sbjct: 109 PPRRRFKYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At3g20610.1 68416.m02608 non-race specific disease resistance protein, putative similar to non-race specific disease resistance protein NDR1 [Arabidopsis thaliana] gi|2754816|gb|AAB95208 Length = 222 Score = 26.6 bits (56), Expect = 8.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 155 YKIGKDYDIEMNMDNYTNKKAVEEFLKMYRTGFMPKNLEF 274 YK+ ++E+N D T K E+ +KM + P+ L F Sbjct: 162 YKLKASVNLEVNEDGATKVKDKEDGIKMKISDSSPQRLTF 201 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,710,577 Number of Sequences: 28952 Number of extensions: 177247 Number of successful extensions: 448 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -