BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31780 (443 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A3.04 |rpl8||60S ribosomal protein L7a |Schizosaccharomyce... 128 5e-31 SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa... 26 3.0 SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces ... 25 4.0 SPAC1851.03 |ckb1||CK2 family regulatory subunit |Schizosaccharo... 25 5.2 SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-gluca... 25 5.2 SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pomb... 25 6.9 SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosa... 24 9.1 SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos... 24 9.1 >SPBC29A3.04 |rpl8||60S ribosomal protein L7a |Schizosaccharomyces pombe|chr 2|||Manual Length = 259 Score = 128 bits (308), Expect = 5e-31 Identities = 59/92 (64%), Positives = 71/92 (77%) Frame = +2 Query: 155 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 334 NPLF RP++F IGQ IQP RDLSRFV+WP+YIR+QR++ +L RLKVPP I QF +TLD Sbjct: 24 NPLFVSRPRSFGIGQDIQPKRDLSRFVKWPEYIRLQRRRKILNLRLKVPPAIAQFQKTLD 83 Query: 335 KTTAKGLFKILEKYRPETEAATKERLRKAAEA 430 K TA +FK+L KYRPET A K+RL AEA Sbjct: 84 KNTATQVFKLLNKYRPETAAEKKQRLVAEAEA 115 >SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Par2|Schizosaccharomyces pombe|chr 1|||Manual Length = 627 Score = 25.8 bits (54), Expect = 3.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 269 KAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILE 370 KAVL LK P IN F + L + +F++LE Sbjct: 463 KAVLTGILKYWPRINSFKELLFLNEIEDIFEVLE 496 >SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 25.4 bits (53), Expect = 4.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 253 PHPAPEGCTSASSESAPSDQPIYPDTGQDY 342 PHP SA S ++P P+ P T +DY Sbjct: 355 PHPRVFSANSAFSTTSPP--PLTPSTSRDY 382 >SPAC1851.03 |ckb1||CK2 family regulatory subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 231 Score = 25.0 bits (52), Expect = 5.2 Identities = 9/13 (69%), Positives = 13/13 (100%) Frame = +2 Query: 341 TAKGLFKILEKYR 379 TA+GL+K+LEKY+ Sbjct: 94 TAQGLYKMLEKYK 106 >SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-glucan synthase Ags1|Schizosaccharomyces pombe|chr 3|||Manual Length = 2410 Score = 25.0 bits (52), Expect = 5.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -1 Query: 305 EGALSDDAEVQPSGAGCGYTWAILQIWTSHELAECPDQWQSSLASSRREDSR 150 +GAL A V G G+ +++ T H L + Q +L+SS+R +R Sbjct: 1538 KGALGIGARVGGLGQMPGWWYSVESSATPHLLKQFEQACQQALSSSQRTRAR 1589 >SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 24.6 bits (51), Expect = 6.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 370 LQNLEKALSCSLVQCLGKLVDRRGHFQTTLKYSL 269 L+N ++ L +L + L +V++ H TTL Y+L Sbjct: 1690 LKNSKQELLAALRKLLSTMVEQNDHTCTTLIYTL 1723 >SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 466 Score = 24.2 bits (50), Expect = 9.1 Identities = 12/52 (23%), Positives = 25/52 (48%) Frame = -1 Query: 296 LSDDAEVQPSGAGCGYTWAILQIWTSHELAECPDQWQSSLASSRREDSRSSW 141 + D+AE++ G +W+++ ++ C D W+ + E +RS W Sbjct: 261 IEDEAELKKLVEKHGTSWSLIGKLSNRLPMHCRDHWRDYIQPG--EINRSPW 310 >SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 24.2 bits (50), Expect = 9.1 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +1 Query: 226 QICKMAQVYPHPAPEGCTSASSESAPSDQPIYPDTGQDYS 345 Q+ A YP+ + SAS S+P+ P T + S Sbjct: 308 QLISKAPSYPYSSSRPSASASLASSPTRSAFRPKTSETVS 347 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,561,374 Number of Sequences: 5004 Number of extensions: 28512 Number of successful extensions: 94 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 162176800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -