BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31771 (363 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 62 1e-12 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.36 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 62.5 bits (145), Expect = 1e-12 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 2 AQGSFSWTSPEGVPISVNYVADXNGYQPTGNAIPTSPPVPXXIARALAY 148 +QGS S+T+P+G +S+ YVAD NG+Q G+ IPT+PP+P I RAL + Sbjct: 71 SQGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTAPPIPPEIQRALEW 119 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.36 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 29 PEGVP-ISVNYVADXNGYQPTGNAIPTSPPVPXXIARA 139 PE VP + ++ G G+ TSPP P I+RA Sbjct: 1369 PERVPTVDLSPSPSDRGRNDDGSDRLTSPPTPLSISRA 1406 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,061 Number of Sequences: 438 Number of extensions: 1376 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8556345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -