BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31769 (516 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyce... 26 2.9 SPBC428.14 |||1-acylglycerol-3-phosphate acyltransferase |Schizo... 25 6.7 >SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 330 Score = 26.2 bits (55), Expect = 2.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 156 AVTATIVRSRINNRPLNTPVNFPTSNNSSFHPIS 55 A+ + S INN PL PV+ N+ +P+S Sbjct: 192 AIPTSEASSSINNTPLQAPVSSFADQNAFTNPLS 225 >SPBC428.14 |||1-acylglycerol-3-phosphate acyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 25.0 bits (52), Expect = 6.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 263 PNPCGLVSDPTLRENLTLNRHNCKFNSVA*SGRIFASNNAVH 388 P P L DP LR L+R+ C ++A I +N+ ++ Sbjct: 65 PTPVTLTYDPELRNLFYLDRNGC-LETIAAERNIVIANHQLY 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,007,740 Number of Sequences: 5004 Number of extensions: 38237 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -