BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31769 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021471-1|CAA16295.1| 241|Caenorhabditis elegans Hypothetical ... 31 0.49 Z70208-8|CAA94143.1| 196|Caenorhabditis elegans Hypothetical pr... 28 3.4 >AL021471-1|CAA16295.1| 241|Caenorhabditis elegans Hypothetical protein Y17D7C.1 protein. Length = 241 Score = 31.1 bits (67), Expect = 0.49 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%) Frame = -1 Query: 225 WFTCHIT-TNSVCWGVFRKRADVIAVTATIVRSRINNRPLNTP-----VNFPTSNNSSF 67 W +CH TNSVC+ +FR++ + + V+ + L P +N PT NN+ + Sbjct: 131 WNSCHRPLTNSVCFTIFREKRESERLGYKPVKMSYIDTSLVEPLKKLEINLPTGNNNGY 189 >Z70208-8|CAA94143.1| 196|Caenorhabditis elegans Hypothetical protein F54B11.8 protein. Length = 196 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/52 (25%), Positives = 25/52 (48%) Frame = -3 Query: 499 FRNFDTFDIKTKLSTRRSKIFDHLSPDD*YTIYTKSLMYSIVRCENSSRLRY 344 ++NFD+F I + R++ ++ D T+Y+ V CE + R+ Sbjct: 36 WKNFDSFKIAILNAAARARATGNIRYDSRMTVYSHPATLQCVDCEEGVKKRF 87 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,958,472 Number of Sequences: 27780 Number of extensions: 211503 Number of successful extensions: 465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -