BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31767 (324 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 1.4 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 1.8 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 3.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 3.2 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 3.2 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 22.2 bits (45), Expect = 1.4 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -1 Query: 252 IFYWTLRYEFVWDR 211 ++YW +YE W R Sbjct: 119 VYYWRQQYEDFWHR 132 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 1.8 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +1 Query: 130 PSTWKRQPAPPKAAHIVSGTEKPVLLAP 213 P+T+ R P H++S ++ +AP Sbjct: 509 PNTYNRHLVAPNGDHVISLIDEISYMAP 536 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.0 bits (42), Expect = 3.2 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +3 Query: 168 CPHRQWN*ETRLTCAYPIRIRSVKSNKIFLRTKKKKKNSRGG 293 CP R+W+ A R V + +FL + N+ G Sbjct: 120 CPRREWSSPPDARAASDAARRGVLYSSVFLGSPGDASNASIG 161 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 3.2 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 Query: 149 SQLPLKLPTSSVELRNPSY 205 S P LPT NP+Y Sbjct: 78 SSTPSSLPTQRTSTSNPTY 96 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.0 bits (42), Expect = 3.2 Identities = 11/42 (26%), Positives = 17/42 (40%) Frame = +3 Query: 168 CPHRQWN*ETRLTCAYPIRIRSVKSNKIFLRTKKKKKNSRGG 293 CP R+W+ A R V + +FL + N+ G Sbjct: 276 CPRREWSSPPDARAASDAARRGVLYSSVFLGSPGDASNASIG 317 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,076 Number of Sequences: 336 Number of extensions: 1245 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6155018 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -