BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31757 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43681| Best HMM Match : MAM (HMM E-Value=2.5e-20) 31 0.74 SB_2516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_43681| Best HMM Match : MAM (HMM E-Value=2.5e-20) Length = 1468 Score = 30.7 bits (66), Expect = 0.74 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 63 CKSYLLTKPSTICNIFTKFLIVVFILINKIFIV 161 C+ L KP+ +CNIF + I + I+I + +V Sbjct: 1183 CQCTLTNKPTGLCNIFNRLHIFIIIIIIIVVVV 1215 >SB_2516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 850 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +3 Query: 18 ITYKICMF-TCECFLNCKSYLLTKPSTIC--NIFTKFLIVVFILINKIFIVYSKRY 176 +T + C F +C CF+ + L++ S +C N F +F +++NK + S Y Sbjct: 334 VTVRRCFFESCSCFVPDRVMPLSRSSAVCTVNAFGRFFCT--MVLNKTRVDTSLNY 387 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,819,980 Number of Sequences: 59808 Number of extensions: 180652 Number of successful extensions: 343 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -