BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31757 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68493-9|CAA92796.1| 338|Caenorhabditis elegans Hypothetical pr... 28 3.4 AC024845-3|AAF60852.1| 619|Caenorhabditis elegans Hypothetical ... 27 8.0 >Z68493-9|CAA92796.1| 338|Caenorhabditis elegans Hypothetical protein C33A12.13 protein. Length = 338 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 48 ECFLNCKSYLLTKPSTICNIFTKFLIVVFILINKIFIVYSK 170 + ++N K P+ + I ++I F++I KIF++YSK Sbjct: 17 DSYMNFKYQFNEFPTFLAIIPWLYMIPTFLVIYKIFLIYSK 57 >AC024845-3|AAF60852.1| 619|Caenorhabditis elegans Hypothetical protein Y65B4BL.2 protein. Length = 619 Score = 27.1 bits (57), Expect = 8.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 401 VWHSSQCDHSKKILL 445 +W+ S CDH K+I+L Sbjct: 87 LWNESDCDHDKRIIL 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,441,804 Number of Sequences: 27780 Number of extensions: 159897 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -