BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31756 (497 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 26 0.82 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 23 7.6 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 25.8 bits (54), Expect = 0.82 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 149 TK*GLHTTLLWGLVSDPKENAPDRFPFPFNVFTL 48 TK GL TLL P E PDR F NVF L Sbjct: 462 TKVGL-ITLLRQFRFSPTEQTPDRIRFMPNVFVL 494 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 22.6 bits (46), Expect = 7.6 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +2 Query: 308 LYTSFVL----SMGKHMFSCALYLRHLYGWVGNTKRGRVPMRRSRPICVRRM*N 457 +Y+S+VL + + SCA++ + + T+R R P +RS P + R N Sbjct: 57 VYSSYVLPKLYAKLHYCVSCAIHSKVVRNRSKETRRIRTPPQRSFPKDMNRQQN 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,148 Number of Sequences: 2352 Number of extensions: 9474 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -