BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31755 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 1.5 U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 25 2.0 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 25 2.0 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 24 3.5 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 6.1 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 60 RVSQGSSLDAATSRACTTPVRRPSPTVGHFTR 155 RV+ SL+ + AC + R P+ GH R Sbjct: 258 RVTSAESLERVMTEACDAAMARVFPSQGHSGR 289 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 24.6 bits (51), Expect = 2.0 Identities = 7/16 (43%), Positives = 14/16 (87%) Frame = -1 Query: 246 LLHSRRPDRRPRACSS 199 L+H ++ ++RPR+C+S Sbjct: 121 LIHEQKGEKRPRSCAS 136 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 346 HLYFLNISIYFCYNFFITS 402 H Y + Y+CY FFIT+ Sbjct: 351 HSYLTILVQYYCYLFFITN 369 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.8 bits (49), Expect = 3.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 307 IGRGQSYAHCAAAGCFSASPAVAFSTARP 221 +G G++YA + SASP+ S A P Sbjct: 55 LGPGRTYASALSPSSSSASPSSPSSVASP 83 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 334 TNRHHLYFLNISIYFCYNFFITSTKLYLF 420 T RH+ +F ++ + F +TS LY+F Sbjct: 57 TQRHYDHFKRQNVPYGGVFMLTSPLLYIF 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 458,209 Number of Sequences: 2352 Number of extensions: 8273 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -