BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31745 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC022458-1|AAH22458.2| 394|Homo sapiens protein arginine methyl... 31 3.2 AF263539-1|AAF91390.1| 334|Homo sapiens arginine N-methyltransf... 31 3.2 AB209027-1|BAD92264.1| 269|Homo sapiens Protein arginine N-meth... 31 3.2 >BC022458-1|AAH22458.2| 394|Homo sapiens protein arginine methyltransferase 8 protein. Length = 394 Score = 30.7 bits (66), Expect = 3.2 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = -1 Query: 243 QXQRNT*IFSL-TIFN---GKTHKPSNFCTVPDGPYL-WK 139 Q QRN + +L T FN K HK F T PD PY WK Sbjct: 297 QIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWK 336 >AF263539-1|AAF91390.1| 334|Homo sapiens arginine N-methyltransferase protein. Length = 334 Score = 30.7 bits (66), Expect = 3.2 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = -1 Query: 243 QXQRNT*IFSL-TIFN---GKTHKPSNFCTVPDGPYL-WK 139 Q QRN + +L T FN K HK F T PD PY WK Sbjct: 237 QIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWK 276 >AB209027-1|BAD92264.1| 269|Homo sapiens Protein arginine N-methyltransferase 4 variant protein. Length = 269 Score = 30.7 bits (66), Expect = 3.2 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = -1 Query: 243 QXQRNT*IFSL-TIFN---GKTHKPSNFCTVPDGPYL-WK 139 Q QRN + +L T FN K HK F T PD PY WK Sbjct: 172 QIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWK 211 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,436,796 Number of Sequences: 237096 Number of extensions: 1477987 Number of successful extensions: 2618 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2618 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -