BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31734 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14170.1 68418.m01657 SWIB complex BAF60b domain-containing p... 31 0.46 At2g25910.1 68415.m03109 3'-5' exonuclease domain-containing pro... 30 0.80 At1g09860.1 68414.m01110 purine permease-related low similarity ... 30 0.80 At1g21380.1 68414.m02675 VHS domain-containing protein / GAT dom... 30 1.1 At4g26900.1 68417.m03870 imidazole glycerol phosphate synthase h... 29 2.5 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 2.5 At2g47410.1 68415.m05917 transducin family protein / WD-40 repea... 28 3.2 At2g25450.1 68415.m03048 2-oxoglutarate-dependent dioxygenase, p... 28 3.2 At1g27720.1 68414.m03388 transcription initiation factor IID (TF... 28 4.3 At3g55940.1 68416.m06216 phosphoinositide-specific phospholipase... 27 5.7 At3g07195.1 68416.m00858 proline-rich family protein 27 5.7 At1g67500.1 68414.m07688 DNA polymerase family B protein similar... 27 5.7 At1g49340.2 68414.m05531 phosphatidylinositol 3- and 4-kinase fa... 27 5.7 At1g49340.1 68414.m05530 phosphatidylinositol 3- and 4-kinase fa... 27 5.7 At3g16550.1 68416.m02113 DegP protease, putative contains simila... 27 7.5 At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding ... 27 9.9 At4g03550.1 68417.m00486 glycosyl transferase family 48 protein ... 27 9.9 At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase... 27 9.9 At1g61930.1 68414.m06986 expressed protein contains Pfam profile... 27 9.9 At1g61080.1 68414.m06877 proline-rich family protein 27 9.9 >At5g14170.1 68418.m01657 SWIB complex BAF60b domain-containing protein similar to brahma associated protein 60 kDa [Drosophila melanogaster] GI:3378134, SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin D1 [Homo sapiens] GI:4566530; contains Pfam profile PF02201: BAF60b domain of the SWIB complex Length = 534 Score = 31.1 bits (67), Expect = 0.46 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 257 PSETRRGNNHTRRFQHEKPQERRGAPADARALQPRR 364 PS T G+ + +RFQ + P GAPA + P R Sbjct: 97 PSLTTPGSLNMKRFQQKPPMRPPGAPASNNTISPMR 132 >At2g25910.1 68415.m03109 3'-5' exonuclease domain-containing protein / K homology domain-containing protein / KH domain-containing protein contains Pfam profiles PF01612: 3'-5' exonuclease, PF00013: KH domain Length = 341 Score = 30.3 bits (65), Expect = 0.80 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 126 SSVRFVQSVPAEPQPRGTRRT-EPPYPPLPVMVTTDP 19 SS + VP P+P G T E PP+P+ + TDP Sbjct: 4 SSPTQLAHVPIPPEPGGRSPTQEANEPPVPIYIVTDP 40 >At1g09860.1 68414.m01110 purine permease-related low similarity to purine permease [Arabidopsis thaliana] GI:7620007; contains Pfam profile PF03151: Domain of unknown function, DUF250 Length = 383 Score = 30.3 bits (65), Expect = 0.80 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%) Frame = +1 Query: 10 NPMGVGSDHHR*GWVRRLSSASSPGLWLC----WYALNESYAGVGVLIHPQVVMTGAHIA 177 NP V + + GW R LS S G+ + YAL + Y G G+L+ Q+++T A Sbjct: 98 NPETVSNQTNN-GWFRVLSLYVSLGVLVSVYSKLYALGKLYVGWGILLSTQLILTSLFSA 156 Query: 178 Y 180 + Sbjct: 157 F 157 >At1g21380.1 68414.m02675 VHS domain-containing protein / GAT domain-containing protein weak similarity to Hrs [Rattus norvegicus] GI:8547026; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 506 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +2 Query: 212 PVEWDTQTIKVNAGPPSETRRGNNHTRRFQHEKPQERRGA 331 P W+TQ + PPS + R N FQH PQ A Sbjct: 402 PAPWETQ--EPRKYPPSMSARTNKRPEYFQHNVPQHSSSA 439 >At4g26900.1 68417.m03870 imidazole glycerol phosphate synthase hisHF, chloroplast / IGP synthase / ImGPP synthase / IGPS identical to SP|Q9SZ30 Imidazole glycerol phosphate synthase hisHF, chloroplast precursor (IGP synthase) {Arabidopsis thaliana} Length = 592 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/57 (35%), Positives = 24/57 (42%) Frame = +2 Query: 191 RAI*EQEPVEWDTQTIKVNAGPPSETRRGNNHTRRFQHEKPQERRGAPADARALQPR 361 RAI E +W + T S RRGN H +F EK E G R L P+ Sbjct: 210 RAIPSDENKDWISSTCNYGESFISSIRRGNVHAVQFHPEKSGE-VGLSVLRRFLHPK 265 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.7 bits (61), Expect = 2.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 108 QSVPAEPQPRGTRRTEPPYPPLP 40 ++ P +P P R PP PPLP Sbjct: 38 ETPPVDPSPSSVHRPYPPPPPLP 60 >At2g47410.1 68415.m05917 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to WDR protein, form B (GI:14970593) [Mus musculus] Length = 1589 Score = 28.3 bits (60), Expect = 3.2 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 133 LLLQRTIRSKRTSRATTQGNSPN*ASVPTPTGDGHY 26 LL Q + S +GN+PN A VPT G G + Sbjct: 122 LLKQLILNPSFPSHMRVEGNAPNAADVPTLLGSGTF 157 >At2g25450.1 68415.m03048 2-oxoglutarate-dependent dioxygenase, putative similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP|P10967) Length = 359 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 482 YHRVSALETKDVLPPAVGDAVLAGVEXVPRVREADHVDV 366 Y R S L+ D + V V AGV VPR+ HV+V Sbjct: 5 YDRASELKAFDEMKIGVKGLVDAGVTKVPRIFHNPHVNV 43 >At1g27720.1 68414.m03388 transcription initiation factor IID (TFIID) component TAF4 family protein contains Pfam profile PF05236: Transcription initiation factor TFIID component TAF4 family Length = 682 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -1 Query: 174 DVSASHDDLRMYQDSYSSVRFVQSVPAEPQPRGTRRTEPPYPPLP-VMVTTDP 19 D S DDL+M+QDS ++ + +PQPR + + P V T DP Sbjct: 16 DSKHSEDDLQMFQDS-----LIRDIEEKPQPRYMKLQKMSSKETPWVEKTVDP 63 >At3g55940.1 68416.m06216 phosphoinositide-specific phospholipase C, putative similar to phosphoinositide specific phospholipase C GI:857374 from [Arabidopsis thaliana] Length = 584 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 180 VSDVSASHDDLRMYQDSYSS--VRFVQSVPAEPQPRGTRRTEPPYPPL 43 V +S S + L + Y+ VRF Q P+GTR T Y PL Sbjct: 348 VRRLSLSEEQLEKASEKYAKQIVRFTQRNLLRVYPKGTRITSSNYNPL 395 >At3g07195.1 68416.m00858 proline-rich family protein Length = 225 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -1 Query: 138 QDSYSSVRFVQSVPAE---PQPRGTRRTEPPYPPLPVMVTT 25 QD Y S+ ++ P E P P+ RR + P P PV T Sbjct: 33 QDLYESIEKPETKPQELAPPPPQPARRIQKPEAPKPVKQDT 73 >At1g67500.1 68414.m07688 DNA polymerase family B protein similar to SP|Q61493 DNA polymerase zeta catalytic subunit (EC 2.7.7.7) {Mus musculus}; contains Pfam profile PF00136: DNA polymerase family B Length = 1890 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/56 (23%), Positives = 24/56 (42%) Frame = -1 Query: 252 PAFTLMVWVSHSTGSCSQIARGVLVSDVSASHDDLRMYQDSYSSVRFVQSVPAEPQ 85 P T + ++H G+CS+ +S + ++ M D Y + PA+ Q Sbjct: 386 PEITDLQALNHMVGTCSEFPASEQLSPLGEKSEEASMENDEYMKTPTDRDTPAQIQ 441 >At1g49340.2 68414.m05531 phosphatidylinositol 3- and 4-kinase family protein contains similarity to phosphatidylinositol 4-kinase 230 GI:2326227 from [Homo sapiens], from [Bos taurus] GI:2198791; contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF00613: Phosphoinositide 3-kinase family, accessory domain Length = 2028 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 293 FVYDYFLDESHLVVQHLP*WSGCPILPALALKLP 192 FV ++E+ +++Q LP W+ C I AL P Sbjct: 1535 FVTPKNVEENSVLLQQLPHWAACSITQALEFLTP 1568 >At1g49340.1 68414.m05530 phosphatidylinositol 3- and 4-kinase family protein contains similarity to phosphatidylinositol 4-kinase 230 GI:2326227 from [Homo sapiens], from [Bos taurus] GI:2198791; contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF00613: Phosphoinositide 3-kinase family, accessory domain Length = 2028 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 293 FVYDYFLDESHLVVQHLP*WSGCPILPALALKLP 192 FV ++E+ +++Q LP W+ C I AL P Sbjct: 1535 FVTPKNVEENSVLLQQLPHWAACSITQALEFLTP 1568 >At3g16550.1 68416.m02113 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 491 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 97 WYALN-ESYAGVGVLIHPQVVMTGAHI 174 W LN ESY G G I + ++T AH+ Sbjct: 77 WQTLNQESYGGSGFAIAGKKILTNAHV 103 >At5g53350.1 68418.m06630 ATP-dependent Clp protease ATP-binding subunit ClpX1 (CLPX) identical to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana] Length = 579 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 281 NHTRRFQHEKPQERRGAPADARALQP 358 NH +R HE Q+R D+ A +P Sbjct: 188 NHYKRIYHESSQKRSAGETDSTAAKP 213 >At4g03550.1 68417.m00486 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1780 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +3 Query: 81 WVV-ALLVRFERIVRWSRSPDTSS-SRHDWRS 170 WV+ AL ++ IV W PDTSS +R W + Sbjct: 308 WVMLALFLQAAIIVAWEEKPDTSSVTRQLWNA 339 >At3g08510.1 68416.m00988 phosphoinositide-specific phospholipase C (PLC2) identical to phosphoinositide specific phospholipase C(AtPLC2) GI:857374 [Arabidopsis thaliana] Length = 581 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 180 VSDVSASHDDLRMYQDSYSS--VRFVQSVPAEPQPRGTRRTEPPYPPL 43 V +S S + L + Y+ VRF Q P+GTR T Y PL Sbjct: 342 VRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNPL 389 >At1g61930.1 68414.m06986 expressed protein contains Pfam profile PF04520: Protein of unknown function, DUF584 Length = 203 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 455 WSPGQIRGDTEENRNRYG 508 WSP I DT EN YG Sbjct: 42 WSPAVIHDDTTENEESYG 59 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 99 PAEPQPRGTRRTEPPYPPLPV 37 P P P GT+ PP PP P+ Sbjct: 550 PPPPPPPGTQAAPPPPPPPPM 570 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,238,972 Number of Sequences: 28952 Number of extensions: 243273 Number of successful extensions: 944 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -