BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31731 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1151 - 9727051-9729510,9733966-9734022,9735299-9735676 28 3.9 07_03_0872 - 22190468-22190575,22190652-22190910,22191005-221911... 27 6.8 >06_01_1151 - 9727051-9729510,9733966-9734022,9735299-9735676 Length = 964 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -3 Query: 136 MIITASFTALTF*XVSDFEGHTPVILRSDRDISN*IN 26 +I+ +FT L V DF G+T ++ + +++SN IN Sbjct: 678 LILPGTFTKLYHMQVLDFIGNTDLVFSAGKEMSNLIN 714 >07_03_0872 - 22190468-22190575,22190652-22190910,22191005-22191108, 22191245-22191423,22191565-22191670,22191797-22191940, 22192024-22192179,22192274-22192378,22192483-22192545, 22192993-22192995 Length = 408 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 282 MEFSSILCFFYILCV 326 M FSSI CFF +LCV Sbjct: 193 MMFSSIACFFELLCV 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,639,907 Number of Sequences: 37544 Number of extensions: 137655 Number of successful extensions: 225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -