BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31731 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09430.1 68416.m01120 hypothetical protein 27 5.7 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 27 7.5 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 27 7.5 >At3g09430.1 68416.m01120 hypothetical protein Length = 247 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +3 Query: 354 KSNRPKXKTQLNIXTEVKLR-PATKLETIHLSNRPPXPXKEIYSSSEHSXSP 506 +SNRP + I +EVK P + T H ++ P +SS E SP Sbjct: 86 ESNRPSKMARSRILSEVKSETPMALVTTAHRNSTPNIINSTKFSSPESYLSP 137 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 148 FTYHYEXEKPKVPYKLXLHV-EPYNIQK 228 + Y Y + P+VPY+ H+ +PYN Q+ Sbjct: 194 YYYGYSLQAPRVPYQHHHHLPQPYNPQQ 221 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 148 FTYHYEXEKPKVPYKLXLHV-EPYNIQK 228 + Y Y + P+VPY+ H+ +PYN Q+ Sbjct: 194 YYYGYSLQAPRVPYQHHHHLPQPYNPQQ 221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,138,772 Number of Sequences: 28952 Number of extensions: 122405 Number of successful extensions: 203 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 202 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -