BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31720 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37070| Best HMM Match : Vicilin_N (HMM E-Value=4.8) 45 3e-05 >SB_37070| Best HMM Match : Vicilin_N (HMM E-Value=4.8) Length = 319 Score = 45.2 bits (102), Expect = 3e-05 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = +1 Query: 379 YFSEKXMMGRNPLLYEQLXGQSLTDEEIKERD 474 +FSE+ M RNPLLYEQ GQ LT+EE ERD Sbjct: 126 FFSEEEMRKRNPLLYEQYIGQYLTEEEKLERD 157 Score = 36.7 bits (81), Expect = 0.011 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 141 KLXMALEIYKRSPVEFLMQFGKYLAPXHIKYFENISSSKDQTFRNY 278 K+ + EI K +P FLM+FG+ L ++YFE++ K T NY Sbjct: 44 KIKILEEIKKTNPASFLMRFGQSLVTKDLEYFESL--YKQNTLTNY 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,295,598 Number of Sequences: 59808 Number of extensions: 147886 Number of successful extensions: 164 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -