BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31718 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 25 0.30 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 25 0.30 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 25 0.53 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 1.6 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 6.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.30 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +1 Query: 124 NIREQVEEEAEGKADLQRQLSKANAEAQLWRSKYESEGVARSEELE-EAXRKLQARLAEA 300 N +++EE+ K D ANA+ ++ + + +A K +L + Sbjct: 1046 NAVQKIEEKKPEKKDKVLTFLGANAQDDEGGLEFSVNKLFKCMICTYKADNKENEQLRKI 1105 Query: 301 EETIESLNQKVXALEK 348 +E++ LN+K+ +LEK Sbjct: 1106 QESLRDLNRKIESLEK 1121 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.4 bits (53), Expect = 0.30 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +1 Query: 124 NIREQVEEEAEGKADLQRQLSKANAEAQLWRSKYESEGVARSEELE-EAXRKLQARLAEA 300 N +++EE+ K D ANA+ ++ + + +A K +L + Sbjct: 1046 NAVQKIEEKKPEKKDKVLTFLGANAQDDEGGLEFSVNKLFKCMICTYKADNKENEQLRKI 1105 Query: 301 EETIESLNQKVXALEK 348 +E++ LN+K+ +LEK Sbjct: 1106 QESLRDLNRKIESLEK 1121 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 24.6 bits (51), Expect = 0.53 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 124 NIREQVEEEAEGKADLQRQLSKANAEAQLWRSKYESE 234 N+R+ + + K D+ +QL + +RSKY+ E Sbjct: 80 NVRKVLHHLIDNKPDMWKQLEAKYDPSGEYRSKYKDE 116 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.0 bits (47), Expect = 1.6 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 247 SEELEEAX-RKLQARLAEAEETIESLNQKVXALEKTXQRLXTEVEDLQLEVDR 402 +E ++EA KL + ++ NQK+ L + ++ +VEDL+ DR Sbjct: 262 NEAIKEAYFPKLDSLVSSRAWPSRVANQKLRDLNREVDQIKQDVEDLKRWSDR 314 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/11 (54%), Positives = 11/11 (100%) Frame = +1 Query: 199 EAQLWRSKYES 231 +AQLW+++YE+ Sbjct: 165 KAQLWQNRYET 175 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 49 RLADEEARERATLLGKFRNLEHDLDNI 129 RL E + ++ LGK L H L + Sbjct: 838 RLIKMETKAQSVALGKICTLHHHLSKL 864 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.306 0.124 0.315 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,519 Number of Sequences: 336 Number of extensions: 1312 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.1 bits)
- SilkBase 1999-2023 -