BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31714 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 28 0.21 AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-tran... 25 2.0 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 27.9 bits (59), Expect = 0.21 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 98 ANEQPVRTCEKLQMALEIYKRSPVEFLMQFGKYLAPNHIKYFE 226 A+++P+ T KL A +I+K + E L F L NH+ E Sbjct: 198 ADQEPI-TKNKLDSASQIFKSTTFELLPAFRDSLKSNHVPLSE 239 >AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-transferase S1-2 protein. Length = 195 Score = 24.6 bits (51), Expect = 2.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 419 VGQYLTDEEIKERDRITENVSFLNLILETVD 511 V Y D+EIKE+ +T N + LE +D Sbjct: 96 VVSYEPDDEIKEKKLVTLNNEVIPFYLEKLD 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 456,187 Number of Sequences: 2352 Number of extensions: 8858 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -