BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31712 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 49 2e-06 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 49 2e-06 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 49 2e-06 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 49 2e-06 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 49 2e-06 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 49 2e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 47 1e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 46 2e-05 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 40 0.002 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 34 0.060 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 30 1.3 SB_50447| Best HMM Match : ProQ (HMM E-Value=0.44) 29 2.3 SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 27 6.9 SB_18320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 6 DVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 62 DVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 630 DVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 41 DVVKRRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 43 DVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 1881 DVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 41 DVVKRRPVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 3 DVVKRRPVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 35 DVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 84 DVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 62 DVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 73 DVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 49 DVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 49.2 bits (112), Expect = 2e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANW 458 DVVKRRPVNCNTTHYRANW Sbjct: 73 DVVKRRPVNCNTTHYRANW 91 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/30 (73%), Positives = 24/30 (80%) Frame = +2 Query: 422 SLATPSRGGARYPIRPIVSRITIHWPSFYN 511 S A + GGA PIRPIVSRITIHWP+FYN Sbjct: 29 SRAAATDGGA--PIRPIVSRITIHWPAFYN 56 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 45.6 bits (103), Expect = 2e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +2 Query: 422 SLATPSRGGARYPIRPIVSRITIHWPSFYN 511 S A + GGA PIRPIVS ITIHWPSFYN Sbjct: 31 SRAAATVGGA--PIRPIVSHITIHWPSFYN 58 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 44.8 bits (101), Expect = 4e-05 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRAN 461 DVVKRRPVNCNTTHYRAN Sbjct: 23 DVVKRRPVNCNTTHYRAN 40 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 461 IRPIVSRITIHWPSFY 508 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRAN 461 D KRRPVNCNTTHYRAN Sbjct: 80 DGEKRRPVNCNTTHYRAN 97 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +2 Query: 461 IRPIVSRITIHWPSFYNV 514 +RP+VSRITIHW SFYNV Sbjct: 33 LRPVVSRITIHWTSFYNV 50 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.1 bits (82), Expect = 0.009 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 467 PIVSRITIHWPSFYNV 514 P +SRITIHWPSFYNV Sbjct: 77 PYMSRITIHWPSFYNV 92 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.060 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 476 SRITIHWPSFYNV 514 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) Length = 634 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = -3 Query: 481 TTHYRANWVPG---PPSRRCGKRGPNSSAAGKRR 389 T H + +W PG PP CG+ P+++++G R Sbjct: 330 TAHAQKSWTPGCCFPPRLGCGRSYPDTNSSGTSR 363 >SB_50447| Best HMM Match : ProQ (HMM E-Value=0.44) Length = 295 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -3 Query: 514 DVVKRRPVNCNTTHYRANWVPGPPSRRCGKRGPNSSAAGKRR 389 D ++ P T H A+ P P R K P A GK+R Sbjct: 243 DEIEEEPPAKRTRHSAASTTPSPRKGRQKKSSPTKQAMGKKR 284 >SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 5.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 469 RANWVPGPPSRRCGK 425 R++W P PPS+ CG+ Sbjct: 139 RSDWTPAPPSKICGR 153 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 460 WVPGPPSRRCGKRGP 416 WVPGP RR RGP Sbjct: 264 WVPGPEQRRDNMRGP 278 >SB_18320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 407 RTVRPSLATPSRGGARYPIRPIVSR 481 +T PSL TP+ G YPI+ + S+ Sbjct: 1 KTAFPSLTTPATKGTGYPIKTVQSQ 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,341,278 Number of Sequences: 59808 Number of extensions: 155270 Number of successful extensions: 902 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -