BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31708 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 149 2e-36 SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 101 3e-22 SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 8e-22 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 3e-21 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 8e-21 SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 2e-19 SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 5e-19 SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) 52 4e-07 SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) 52 4e-07 SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 51 5e-07 SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 48 6e-06 SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) 36 0.026 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 29 3.0 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 28 4.0 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) 28 4.0 SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) 28 4.0 SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) 28 5.3 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 28 5.3 SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) 28 5.3 SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) 28 5.3 SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 27 6.9 SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) 27 6.9 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_31879| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4) 27 6.9 SB_25245| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) 27 6.9 SB_35013| Best HMM Match : Exo_endo_phos (HMM E-Value=0.027) 27 6.9 SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_22411| Best HMM Match : Kinesin (HMM E-Value=6.8e-17) 27 6.9 SB_12999| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-10) 27 6.9 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 27 6.9 SB_57443| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) 27 9.2 >SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 969 Score = 149 bits (360), Expect = 2e-36 Identities = 79/169 (46%), Positives = 99/169 (58%) Frame = +2 Query: 5 DGCSSARKAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTL 184 D + +K + AA K L+ + KSL+KKYLT E+F+ LK+KKT G TL Sbjct: 171 DMYNGVKKLLEIEKAAVEAKRNVFPEVLKKPEVKSLMKKYLTEEMFNELKDKKTELGVTL 230 Query: 185 LDCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGXKKTDKHPPKNWGDVDTL 364 DCI SGVENLDSG GIYA D ESY +FA LFD IIEDYH K KH + Sbjct: 231 SDCINSGVENLDSGTGIYAGDEESYKLFAPLFDKIIEDYHAPYKLEQKHTSDMNPEKVEA 290 Query: 365 GNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXXXKEMEDKVSGTLSSL 511 +LDP G F+ STR+R R+L+GY P L++ E+E+KV SL Sbjct: 291 PDLDPEGSFIRSTRIRVARNLKGYALTPALSKKARLEIEEKVKNVFESL 339 Score = 148 bits (358), Expect = 3e-36 Identities = 78/158 (49%), Positives = 98/158 (62%), Gaps = 1/158 (0%) Frame = +2 Query: 41 VDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 217 ++ A +E+ F + L+ + KSLLKKYLT +VF+SLK KKTS G+ L DCI SGV NL Sbjct: 614 IERAAIEEAHLKFPEDLKKPEVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNL 673 Query: 218 DSGVGIYAPDAESYSVFAELFDPIIEDYHNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVV 397 DSG G+YA D E Y VF ELFD IIEDYH K + H + NLD G F+ Sbjct: 674 DSGTGVYAADEECYEVFGELFDKIIEDYHAPYKLEENHKSDMDPEKVDAPNLDAEGAFIR 733 Query: 398 STRVRCGRSLEGYPFNPCLTEXXXKEMEDKVSGTLSSL 511 STR+R R+L+GY P LT ++E KV G L+SL Sbjct: 734 STRIRVARNLKGYALTPGLTRKERVDVESKVVGVLNSL 771 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 101 bits (243), Expect = 3e-22 Identities = 71/190 (37%), Positives = 98/190 (51%), Gaps = 28/190 (14%) Frame = +2 Query: 26 KAATMVDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTL------ 184 K+ ++ A +EK + F + L + KSLLKKYLT E+F+SLK+KKT+ G +L Sbjct: 337 KSLLEIERAAIEKQRSVFPEALNKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINS 396 Query: 185 ----------------LDCIQSGVENLDSGVG-----IYAPDAESYSVFAELFDPIIEDY 301 L+CI+ ++ V + D ESYS+F+ LFD I+E Y Sbjct: 397 GVVNLDSSCGVYAGQRLECIRHIANSISVRVADVFYHLSTGDEESYSLFSPLFDKIVEHY 456 Query: 302 HNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXXXKEME 481 H K DKH + T NLDP G F+ STR+R R+L+GY P LT E+E Sbjct: 457 HAPYKLADKHTSDMNPEKVTAPNLDPDGVFIRSTRIRVARNLKGYALTPGLTRKERNEIE 516 Query: 482 DKVSGTLSSL 511 KV+ L SL Sbjct: 517 KKVTEVLCSL 526 Score = 85.0 bits (201), Expect = 3e-17 Identities = 61/150 (40%), Positives = 73/150 (48%), Gaps = 16/150 (10%) Frame = +2 Query: 38 MVDAATLEKLEAGFS-----KLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQS 202 M DAA EK + + K + K LLKKYLT +VFD LK KKT G Sbjct: 8 MADAAEAEKYRSKNAYPVPLKSAKCNPKCLLKKYLTNQVFDQLKTKKTKRGDGGCSDGGG 67 Query: 203 GVENLDSGVGIYAP---------DAESYSVFAELFDPIIEDYHNGXKKTDKHPPKNWGDV 355 G ++D G Y D ESY+VFA LFD +IEDYH+ K D H D Sbjct: 68 GGGDVDDDDGEYIDADVAVVIVGDEESYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDR 127 Query: 356 DTLGNLDPAGEFVVSTRVRCGRSLEG--YP 439 +LDP F+ STR+R GR L G YP Sbjct: 128 VNAPDLDPDNRFIRSTRIRVGRDLAGKYYP 157 >SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 100 bits (239), Expect = 8e-22 Identities = 62/144 (43%), Positives = 75/144 (52%), Gaps = 9/144 (6%) Frame = +2 Query: 104 KSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENLDSGVGIYAP---------DAES 256 K LLKKYLT +VFD LK KKT G G ++D G Y D ES Sbjct: 174 KCLLKKYLTNQVFDQLKTKKTKRGDGGCSDGGGGGGDVDDDDGEYIDADVAVVIVGDEES 233 Query: 257 YSVFAELFDPIIEDYHNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGY 436 Y+VFA LFD +IEDYH+ K D H D +LDP F+ STR+R GR+L+GY Sbjct: 234 YTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRNLKGY 293 Query: 437 PFNPCLTEXXXKEMEDKVSGTLSS 508 P LT+ E+E K S T S Sbjct: 294 GLAPSLTKKERVELEKKASFTAKS 317 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 98.3 bits (234), Expect = 3e-21 Identities = 57/139 (41%), Positives = 80/139 (57%), Gaps = 4/139 (2%) Frame = +2 Query: 107 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAE 274 +L+ K+LT ++ L++K T G TL IQ+GV+N S VG+ A D ESY FAE Sbjct: 61 NLMAKHLTPRLYVKLRDKSTPNGYTLDQAIQTGVDNPGHPFISTVGLVAGDEESYDTFAE 120 Query: 275 LFDPIIEDYHNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCL 454 LFDP+IE+ H+G KK+DKH G D ++V+S+RVR GRS+ G+ P Sbjct: 121 LFDPVIEERHSGFKKSDKHKTDLDSSKIRGGKFDE--KYVLSSRVRTGRSIRGFSLPPHC 178 Query: 455 TEXXXKEMEDKVSGTLSSL 511 T +E+E V+ L L Sbjct: 179 TRAERREVERIVNDALDGL 197 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 97.1 bits (231), Expect = 8e-21 Identities = 59/138 (42%), Positives = 79/138 (57%), Gaps = 4/138 (2%) Frame = +2 Query: 113 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAELF 280 + K LT+E++ SL++K T G TL D IQ+GV+N VG A D ESY VFAEL Sbjct: 2323 MAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDNPGHPFIMTVGCVAGDEESYDVFAELL 2382 Query: 281 DPIIEDYHNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTE 460 DP+IE H G KKTDKH D G LDP ++V+S+RVR GRS+ G+ P + Sbjct: 2383 DPVIELRHGGYKKTDKHKTDLNPDNLKGGALDP--KYVLSSRVRTGRSIRGFCLPPHCSR 2440 Query: 461 XXXKEMEDKVSGTLSSLE 514 + +E L+ L+ Sbjct: 2441 AERRSVEKISVDALAKLD 2458 >SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 92.3 bits (219), Expect = 2e-19 Identities = 56/137 (40%), Positives = 76/137 (55%), Gaps = 4/137 (2%) Frame = +2 Query: 113 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAELF 280 + ++L+ ++ LK+K T G TL IQ+GV+N S VG+ A D ESY VFA+LF Sbjct: 404 MARHLSPRLYTKLKDKVTPNGYTLDMAIQTGVDNPGHPFISTVGLVAGDEESYDVFADLF 463 Query: 281 DPIIEDYHNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTE 460 DP+IE+ HNG KKTDKH G+ D +V+STR R GRS+ G+ P T Sbjct: 464 DPVIEERHNGYKKTDKHVTDLNHRKLKGGSFDE--RYVLSTRCRTGRSIRGFSLPPHCTR 521 Query: 461 XXXKEMEDKVSGTLSSL 511 + +E V L L Sbjct: 522 AERRSVEKVVVDALDQL 538 >SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1115 Score = 91.1 bits (216), Expect = 5e-19 Identities = 63/175 (36%), Positives = 91/175 (52%), Gaps = 5/175 (2%) Frame = +2 Query: 5 DGCSSARKAATMVDAATLEKLEAGFSKLQGSD-SKSLLKKYLTREVFDSLKNKKTSFGST 181 + S AR+ A +A +K + ++ G + ++ + K+LTR+V++ L N KT G T Sbjct: 731 ESVSKAREEAIKKEAER-QKASSTLRRVPGPEQAQHYMAKFLTRDVYNKLCNLKTPSGFT 789 Query: 182 LLDCIQSGVENLDSG----VGIYAPDAESYSVFAELFDPIIEDYHNGXKKTDKHPPKNWG 349 L IQ+GV+N VG A D E+Y VFA L DP+IE HNG K KH Sbjct: 790 LDGVIQTGVDNPGHPFIFTVGCVAGDEETYKVFAALLDPVIEARHNGYLKGAKHVTDLNP 849 Query: 350 DVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXXXKEMEDKVSGTLSSLE 514 D + +G D FV+S RVR GRS+ G P T +E+E L++L+ Sbjct: 850 D-NLVGGDDLDANFVLSCRVRTGRSIRGLGLPPHCTRAERREVEKITVDALATLD 903 Score = 89.0 bits (211), Expect = 2e-18 Identities = 55/138 (39%), Positives = 76/138 (55%), Gaps = 4/138 (2%) Frame = +2 Query: 113 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAELF 280 + K LT V++ L KT G TL IQ+GV+N VG A D ESY VFA++F Sbjct: 370 MAKCLTPAVYNMLSVLKTPTGYTLDMAIQTGVDNPGHPFIMTVGCVAGDEESYDVFADMF 429 Query: 281 DPIIEDYHNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTE 460 DP+IE HNG KKT KH + + +G D ++V+S RVR GRS+ G P + Sbjct: 430 DPVIEKRHNGYKKTAKH-KTDLNPSNLIGGDDLDEKYVLSCRVRTGRSIRGLCLPPWCSR 488 Query: 461 XXXKEMEDKVSGTLSSLE 514 +E+E V+ L+ L+ Sbjct: 489 AERREVEKIVTSALAELD 506 Score = 88.6 bits (210), Expect = 3e-18 Identities = 54/138 (39%), Positives = 75/138 (54%), Gaps = 4/138 (2%) Frame = +2 Query: 113 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPDAESYSVFAELF 280 + K +T++V+ L N +T G TL IQ+GV+N VG A D ESY VFA++F Sbjct: 1 MAKCMTKDVYQRLSNLRTPSGYTLDMAIQTGVDNPGHPFIMTVGCVAGDEESYDVFADMF 60 Query: 281 DPIIEDYHNGXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTE 460 DP+IE H+G +KTD H D +G D ++V+S RVR GRS+ G P T Sbjct: 61 DPVIEKRHDGYRKTDMHKTDLNPD-HLIGGDDLDEKYVLSCRVRTGRSIRGLGLPPHCTR 119 Query: 461 XXXKEMEDKVSGTLSSLE 514 +E+E L SL+ Sbjct: 120 AERREVEKVSVEALDSLD 137 >SB_54283| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=1.4e-13) Length = 490 Score = 51.6 bits (118), Expect = 4e-07 Identities = 24/72 (33%), Positives = 41/72 (56%) Frame = +2 Query: 86 LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENLDSGVGIYAPDAESYSV 265 LQ + K++ ++L +++ K+ KT +G L D + V D+ +GI A D E Y Sbjct: 63 LQQKNRKTVASQFLNEAIYEEYKDAKTVYGFRLFDILSYDVSYRDT-IGIRATDEECYYT 121 Query: 266 FAELFDPIIEDY 301 F +LFDP+I ++ Sbjct: 122 FIKLFDPVISNF 133 Score = 33.1 bits (72), Expect = 0.14 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 353 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXXXKEMEDKVSGTLSSLE 514 V G LD VVS RVR RSL+G+PF + +E+++ V L SL+ Sbjct: 279 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQALDSLK 329 >SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) Length = 322 Score = 51.6 bits (118), Expect = 4e-07 Identities = 24/72 (33%), Positives = 41/72 (56%) Frame = +2 Query: 86 LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENLDSGVGIYAPDAESYSV 265 LQ + K++ ++L +++ K+ KT +G L D + V D+ +GI A D E Y Sbjct: 54 LQQKNRKTVASQFLNEAIYEEYKDAKTVYGFRLFDILSYDVSYRDT-IGIRATDEECYYT 112 Query: 266 FAELFDPIIEDY 301 F +LFDP+I ++ Sbjct: 113 FIKLFDPVISNF 124 Score = 33.1 bits (72), Expect = 0.14 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +2 Query: 353 VDTLGNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXXXKEMEDKVSGTLSSLE 514 V G LD VVS RVR RSL+G+PF + +E+++ V L SL+ Sbjct: 270 VGVTGTLDA---HVVSCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQALDSLK 320 >SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 309 Score = 51.2 bits (117), Expect = 5e-07 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 1/96 (1%) Frame = +2 Query: 227 VGIYAPDAESYSVFAELFDPIIEDYHNGXK-KTDKHPPKNWGDVDTLGNLDPAGEFVVST 403 +G +A D ESY F + + P+I+ YH G T KH + + D A ++ST Sbjct: 1 MGCHAGDKESYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKISTELSDSAKAKIIST 60 Query: 404 RVRCGRSLEGYPFNPCLTEXXXKEMEDKVSGTLSSL 511 R+R R+L +P NP ++ E+ D ++ SL Sbjct: 61 RIRVARNLSMFPLNPGGSKESRLEIIDLMAKVYDSL 96 >SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 383 Score = 47.6 bits (108), Expect = 6e-06 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 1/109 (0%) Frame = +2 Query: 188 DCIQSGVENLDSGVGIYAPDAESYSVFAELFDPIIEDYHNGXK-KTDKHPPKNWGDVDTL 364 D SG I D ESY F + + P+I+ YH G T KH + + Sbjct: 80 DTKSSGPAKWTLARAINTGDKESYDDFKDFYYPVIQAYHKGFDINTSKHVTDMDPEKIST 139 Query: 365 GNLDPAGEFVVSTRVRCGRSLEGYPFNPCLTEXXXKEMEDKVSGTLSSL 511 D A ++STR+R R+L +P NP ++ E+ D ++ SL Sbjct: 140 ELSDSAKAKIISTRIRVARNLSMFPLNPGGSKESRLEIIDLMAKVYDSL 188 >SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) Length = 132 Score = 35.5 bits (78), Expect = 0.026 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = +2 Query: 107 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENLD----SGVGIYAPDAESY 259 +++ ++LT E++ L ++KTS G TL IQ GV+N S GI A D ES+ Sbjct: 77 NIMARHLTPEMYVHLCDRKTSNGFTLDQAIQPGVDNPTHPNISPCGIVAGDEESF 131 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 28.7 bits (61), Expect = 3.0 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +2 Query: 26 KAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSG 205 KAA + + L KL AG++ L D+ L + LT E LK K S + +Q Sbjct: 195 KAAVQLLKSVLPKLTAGYADLYHGDA---LVEVLTTEWHGDLKEKYPQDVSGIYQLVQGQ 251 Query: 206 VENLD 220 +E+ D Sbjct: 252 LESRD 256 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 308 GXKKTDKHPPKNWGDVDTLGNLDPAGEF 391 G K + PP + G+ DT G D GEF Sbjct: 9 GGSKGFRPPPYSCGEFDTRGEFDTCGEF 36 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -1 Query: 441 KGYPSSERPQRTRVETTNS-PAGSRLPSVSTSP 346 +G SSERP+R+R T + P S LP +++P Sbjct: 1178 RGSLSSERPERSRRRRTETEPRDSSLPCTASTP 1210 >SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) Length = 277 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = -3 Query: 157 VLQAVEYFPGKVLLQQRLRVGSLELAETSLQFLEGCGVDH 38 + +AV P +V+L R+++GS +LA+ L+ L+G G++H Sbjct: 204 ITRAVIDGPLRVVL--RVQIGSCDLADEHLRKLDGGGLEH 241 >SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) Length = 362 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 231 PTPESKFSTPDWMQSRRVDPNEVFLFFRLSNTS 133 P P+ KFS P + SR +D E L F L+ S Sbjct: 5 PKPKEKFSEPVIIASRNLDSVEARLAFNLTTVS 37 >SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) Length = 353 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 68 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 196 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 30 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 73 >SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) Length = 809 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 65 QDRAADKNHVYISYR-DCKKLDEEAFPEDLDEAPWSVL 101 >SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) Length = 398 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 68 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 196 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 75 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 118 >SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) Length = 617 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 3 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 107 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 534 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 568 >SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 3 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 107 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 70 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 104 >SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) Length = 326 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 308 GXKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRVR-CGRSLEGYPFNPC 451 G + +H P NWG+ + + + TR R C L Y PC Sbjct: 188 GKCQLQEHCPGNWGEWSSWSSCSVTCDLGTKTRTRKCDNPLPKYGGKPC 236 >SB_45985| Best HMM Match : IQ (HMM E-Value=1.7e-37) Length = 942 Score = 27.5 bits (58), Expect = 6.9 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +3 Query: 36 QWSTPQPSRNWRL-VSASSRDPTLSRC*RSTLPGKYSTA*RTKRPHSDPPSLTASNRVSR 212 +W P PS N V SS DP L R S+ P + ++ + S+ PS +S R + Sbjct: 851 EWRPPSPSPNTEADVKESSDDPPL-RQRTSSFPVEINSTYPPRYASSNSPSAPSSPRTTA 909 Query: 213 TWTPAS 230 ++ A+ Sbjct: 910 SYGTAT 915 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 27.5 bits (58), Expect = 6.9 Identities = 26/84 (30%), Positives = 33/84 (39%) Frame = +3 Query: 3 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLSRC*RSTLPGKYSTA*RTKRPHSDPP 182 L+ P P STP R S S T S + P ST T HS P Sbjct: 9 LSTPSTPCTPSTPSTPSTPSTPRTPSTPSTPCTPSTPSTPSTPITPSTP-STPCTHSTPS 67 Query: 183 SLTASNRVSRTWTPASVSTRRTPS 254 + + + S TP++ ST TPS Sbjct: 68 APSTPSTPSTPCTPSTPSTPSTPS 91 >SB_31879| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4) Length = 200 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 145 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 181 >SB_25245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 101 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 137 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 337 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 373 >SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) Length = 432 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 145 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 181 >SB_35013| Best HMM Match : Exo_endo_phos (HMM E-Value=0.027) Length = 381 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 189 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 225 >SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 101 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 137 >SB_22411| Best HMM Match : Kinesin (HMM E-Value=6.8e-17) Length = 505 Score = 27.5 bits (58), Expect = 6.9 Identities = 24/76 (31%), Positives = 34/76 (44%) Frame = +3 Query: 21 PEKPQQWSTPQPSRNWRLVSASSRDPTLSRC*RSTLPGKYSTA*RTKRPHSDPPSLTASN 200 P +P++ + PQPS+N S S P RS P S A R S P+ Sbjct: 278 PTQPRRSNLPQPSKNHASRSQSPAPPRGRSLKRSKSPAPGSAA--AARSRSPSPAR---- 331 Query: 201 RVSRTWTPASVSTRRT 248 S T TP ++S+ +T Sbjct: 332 --SSTSTPPTISSVKT 345 >SB_12999| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-10) Length = 734 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 605 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 641 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 192 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 79 Q R D N V++ +R L F DL+ PWS+L Sbjct: 119 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 155 >SB_57443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1007 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -1 Query: 438 GYPSSERPQRTRVETTNSPAGSRLPSVSTSPQFLGGCLSVFXXPLW 301 G R QR R +T P+ + S+ + LGG + + P W Sbjct: 513 GLEEIHRQQRARYTSTTRPSSASSKSLLLTTLLLGGDIQINPGPNW 558 >SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) Length = 242 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 162 RPHSDPPSLTASNRVSRTWTPASVST--RRTP 251 RPH+DP TWTP +T RTP Sbjct: 175 RPHTDPTQTPHGPHTDPTWTPHRPNTDPTRTP 206 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,637,605 Number of Sequences: 59808 Number of extensions: 274756 Number of successful extensions: 1004 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -