BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31705 (394 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0039 - 10490522-10490606,10490674-10490810,10491107-104912... 83 1e-16 05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970,211... 79 2e-15 01_06_0158 - 27079262-27079346,27079662-27079750,27080540-270806... 78 3e-15 05_07_0145 + 28012268-28012624,28012734-28012794,28013758-280138... 74 5e-14 01_05_0795 + 25287449-25287967,25288078-25288138,25288640-252887... 71 4e-13 02_05_0763 + 31583449-31583747,31584095-31584230,31584544-315845... 42 2e-04 05_06_0040 + 25116732-25118030 40 0.001 07_03_0712 - 20878272-20879633 39 0.001 04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861,854... 37 0.005 09_06_0132 - 21042653-21042873,21042950-21043027,21043106-210431... 36 0.012 06_03_0732 + 23965090-23965431,23965610-23965746,23967359-239674... 36 0.012 04_04_1647 + 35032328-35033803 36 0.012 03_02_0811 + 11437654-11438958 36 0.012 09_04_0549 + 18478475-18478664,18479381-18480648 36 0.015 09_04_0547 + 18467016-18467205,18467922-18469189 36 0.015 07_03_0705 - 20846810-20848165 36 0.015 12_01_0345 - 2649701-2650819 35 0.020 07_03_0708 - 20865786-20867153 35 0.020 03_02_0806 + 11391880-11391916,11392247-11393634 35 0.020 06_03_1412 + 29993566-29993873,29993960-29994583,29994665-299948... 35 0.027 03_02_0809 + 11419318-11420493 34 0.035 01_06_0258 + 27950196-27950749,27953670-27954570 34 0.035 01_01_0555 + 4080316-4081680 34 0.035 09_04_0355 + 16922863-16924224 34 0.047 09_04_0353 + 16915618-16916934 34 0.047 04_03_0432 - 15861997-15862096,15862449-15862519,15862612-158627... 34 0.047 03_02_0807 + 11398845-11399999 34 0.047 01_06_0905 + 32880368-32880633,32882439-32882568,32882704-328828... 34 0.047 01_06_0523 - 30009191-30010531 34 0.047 05_04_0147 - 18419864-18421297 33 0.062 02_05_0626 - 30456714-30456829,30456951-30457023,30457136-304572... 33 0.11 07_03_0704 + 20831071-20832381 32 0.14 05_04_0099 - 17991569-17993014 32 0.14 04_04_0040 + 22322839-22324173 32 0.14 04_03_0428 - 15820169-15820236,15820296-15820367,15820450-158205... 32 0.14 04_03_0418 - 15686775-15686842,15686902-15686973,15687056-156871... 32 0.14 02_03_0194 - 16215032-16215177,16215322-16215393,16215518-162155... 32 0.14 02_02_0636 + 12463660-12465204 32 0.14 06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253,896... 32 0.19 05_07_0313 - 29159638-29161065 32 0.19 01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 32 0.19 06_01_0746 + 5580755-5582119 31 0.25 01_01_0261 + 2119519-2121033 31 0.25 07_03_0710 - 20873420-20874745 31 0.33 05_07_0071 - 27481876-27482737,27484328-27484950 31 0.33 04_04_1586 - 34621945-34623366 31 0.33 04_04_0042 + 22328464-22329858 31 0.33 02_05_0552 - 29911280-29912541,29912633-29912762 31 0.33 12_02_0913 + 24246217-24247557 31 0.44 08_02_0960 + 23058393-23059739 31 0.44 07_03_1115 - 24076506-24076677,24077169-24077266,24077622-240777... 31 0.44 02_05_0551 + 29907768-29907909,29907995-29909280 31 0.44 04_03_0316 + 14261942-14262506,14262710-14263134 30 0.58 04_01_0509 + 6668208-6668653,6669776-6669779 30 0.58 03_02_0519 + 9066918-9068261 30 0.58 01_06_1318 - 36261483-36262811 30 0.58 12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896,393... 30 0.76 01_05_0596 + 23511148-23512650 30 0.76 10_08_0774 + 20478203-20479393 29 1.0 01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 29 1.0 10_08_0769 + 20452130-20453314 29 1.3 10_08_0766 + 20437772-20438956 29 1.3 09_06_0239 - 21794691-21795986 29 1.3 06_01_0772 + 5770502-5770619,5771035-5772335 29 1.3 10_01_0182 - 2052037-2052044,2053163-2053748,2055337-2055396 29 1.8 03_02_0810 + 11429776-11429985,11430003-11430935 29 1.8 11_01_0539 + 4268326-4268450,4268586-4268751 28 2.3 10_08_0770 + 20459888-20461036 28 2.3 08_01_0711 - 6275052-6276401 28 2.3 02_05_0554 + 29929860-29929959,29932944-29934220 28 3.1 10_08_0773 + 20474642-20475835 27 4.1 10_08_0772 + 20471748-20473004 27 4.1 01_07_0213 - 42028941-42029055,42029444-42029480,42029876-420302... 27 4.1 10_08_0775 + 20484776-20486035 27 5.4 02_02_0026 + 6187860-6187940,6188136-6188207,6188302-6188395,618... 27 5.4 10_08_0778 + 20492822-20493920,20494605-20494648 27 7.1 06_01_0418 - 2979418-2981404,2984505-2986469,2987164-2988053 27 7.1 04_04_0768 - 27954149-27954911,27954955-27955328 27 7.1 09_06_0186 + 21427739-21428813,21428894-21428977,21429136-21429254 26 9.4 07_03_1556 + 27692770-27694119 26 9.4 04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035,807... 26 9.4 02_05_1269 + 35352825-35352888,35353645-35353968,35355062-353551... 26 9.4 02_05_0367 - 28331479-28332358,28332432-28332988,28333454-283336... 26 9.4 01_03_0113 - 12647599-12648052,12648078-12648319 26 9.4 01_01_0452 - 3357687-3358332,3358779-3359641 26 9.4 >01_02_0039 - 10490522-10490606,10490674-10490810,10491107-10491248, 10491355-10491419,10491528-10491641,10491846-10492119, 10492215-10492327,10492405-10492499,10492602-10492662, 10492774-10493103 Length = 471 Score = 82.6 bits (195), Expect = 1e-16 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = +1 Query: 220 RLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCHYT 387 RL+ D G PL NYLD QY+G I IGTPPQ+F V+FDTGS NLWVPS KC+++ Sbjct: 55 RLRADGLGDDIVPLDNYLDTQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSVKCYFS 110 >05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970, 2116072-2116184,2116278-2116551,2116923-2117036, 2117169-2117233,2117325-2117466,2117547-2117666, 2118153-2118241,2118349-2118433 Length = 496 Score = 78.6 bits (185), Expect = 2e-15 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = +1 Query: 223 LKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCHYT 387 LK + P PL +YL+ QYYGVI +G+PPQ+F V+FDTGS NLWVPS KC+++ Sbjct: 57 LKTGSSDSDPVPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKCYFS 111 >01_06_0158 - 27079262-27079346,27079662-27079750,27080540-27080659, 27080738-27080894,27081167-27081231,27081323-27081436, 27082109-27082178,27082412-27082642,27082963-27083039, 27083143-27083237,27084514-27084574,27084678-27085073 Length = 519 Score = 77.8 bits (183), Expect = 3e-15 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +1 Query: 259 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCH 381 L NYL+AQYYG I+IGTPPQ F V+FDTGS NLWVPS KCH Sbjct: 90 LKNYLNAQYYGEIAIGTPPQMFTVIFDTGSSNLWVPSSKCH 130 >05_07_0145 + 28012268-28012624,28012734-28012794,28013758-28013852, 28013944-28014056,28014436-28014604,28014677-28014716, 28014797-28014861,28015485-28015598,28015687-28015751, 28015927-28016083,28016167-28016286,28016447-28016535, 28016631-28016715 Length = 509 Score = 73.7 bits (173), Expect = 5e-14 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +1 Query: 259 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCHYT 387 L NY++AQY+G I +GTPPQ F V+FDTGS NLWVPS KC+++ Sbjct: 77 LKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFS 119 >01_05_0795 + 25287449-25287967,25288078-25288138,25288640-25288734, 25288827-25288939,25289480-25289648,25289777-25289816, 25289906-25289970,25290150-25290263,25290398-25290462, 25290572-25290725,25290798-25290914,25292489-25292545 Length = 522 Score = 70.5 bits (165), Expect = 4e-13 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 250 PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCHYT 387 P L N+L+AQY+G I +G PPQ+F VVFDTGS NLWVPS KC ++ Sbjct: 128 PLALKNFLNAQYFGEIGVGCPPQNFTVVFDTGSSNLWVPSAKCVFS 173 >02_05_0763 + 31583449-31583747,31584095-31584230,31584544-31584593, 31585586-31585852,31586481-31586708,31586873-31587011, 31587091-31587161,31587313-31587412,31588201-31588264, 31588346-31588417,31588500-31588720 Length = 548 Score = 41.9 bits (94), Expect = 2e-04 Identities = 31/76 (40%), Positives = 35/76 (46%) Frame = +1 Query: 139 ALYRVPLHRMKTARTHFHEVGTELELLRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQ 318 AL R L R K VG + +LL L G S P N L YY + +GTP Sbjct: 63 ALVRSDLQRQK------RRVGGKYQLLSLSQ---GGSIFPSGNDLGWLYYTWVDVGTPNT 113 Query: 319 SFKVVFDTGSCNLWVP 366 SF V DTGS WVP Sbjct: 114 SFLVALDTGSDLFWVP 129 >05_06_0040 + 25116732-25118030 Length = 432 Score = 39.5 bits (88), Expect = 0.001 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +1 Query: 253 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVP 366 EP++ Y D Y +++G PPQ F+V DTGS WVP Sbjct: 16 EPVTTYTDG-YLLSLNLGMPPQVFQVYLDTGSDLTWVP 52 >07_03_0712 - 20878272-20879633 Length = 453 Score = 39.1 bits (87), Expect = 0.001 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 235 VTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 V+ P+ + L N +Y ++IGTPPQS+ + DTGS +W C Sbjct: 78 VSAPTRKDLPN--GGEYIMTLAIGTPPQSYPAIADTGSDLVWTQCAPC 123 >04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861, 8540190-8540413,8540491-8540715,8541520-8541619, 8541703-8541763,8543029-8543100,8543183-8543406 Length = 477 Score = 37.1 bits (82), Expect = 0.005 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVP 366 +Y ++++GTP Q+F V DTGS W+P Sbjct: 116 HYALVTVGTPGQTFMVALDTGSDLFWLP 143 >09_06_0132 - 21042653-21042873,21042950-21043027,21043106-21043167, 21043504-21043578,21043664-21043752,21043825-21043905, 21044939-21045076,21046299-21046429,21046521-21046592, 21047218-21047275,21047362-21047461,21047544-21047617, 21047701-21047836,21047913-21048137,21048211-21048446, 21048949-21049081,21049195-21049484 Length = 732 Score = 35.9 bits (79), Expect = 0.012 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVP 366 +Y V+++GTP +F V DTGS WVP Sbjct: 99 HYAVVALGTPNVTFLVALDTGSDLFWVP 126 >06_03_0732 + 23965090-23965431,23965610-23965746,23967359-23967417, 23968817-23970135 Length = 618 Score = 35.9 bits (79), Expect = 0.012 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y + +GTP + VVFDTGS WV + C Sbjct: 282 YVVTVGLGTPASRYTVVFDTGSDTTWVQCQPC 313 >04_04_1647 + 35032328-35033803 Length = 491 Score = 35.9 bits (79), Expect = 0.012 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 238 TGPSPEPLSNYLDAQYYG---VISIGTPPQSFKVVFDTGSCNLWVP 366 T P P ++ Y G +S+GTPPQ V+ +TGS WVP Sbjct: 71 TAPPPSVRASLYPHSYGGYAFTVSLGTPPQPLPVLLETGSHLSWVP 116 >03_02_0811 + 11437654-11438958 Length = 434 Score = 35.9 bits (79), Expect = 0.012 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +1 Query: 220 RLKYDVTGP-SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 RL + P SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 59 RLSSSASAPVSPGTYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 113 >09_04_0549 + 18478475-18478664,18479381-18480648 Length = 485 Score = 35.5 bits (78), Expect = 0.015 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >09_04_0547 + 18467016-18467205,18467922-18469189 Length = 485 Score = 35.5 bits (78), Expect = 0.015 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >07_03_0705 - 20846810-20848165 Length = 451 Score = 35.5 bits (78), Expect = 0.015 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 295 ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +SIGTPP +F V+ DTGS +W C Sbjct: 94 LSIGTPPVTFSVLADTGSSLIWTQCAPC 121 >12_01_0345 - 2649701-2650819 Length = 372 Score = 35.1 bits (77), Expect = 0.020 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y+ IS+GTPP V DTGS WV K C Sbjct: 24 KYFMGISLGTPPVFNLVTIDTGSTLSWVQCKNC 56 >07_03_0708 - 20865786-20867153 Length = 455 Score = 35.1 bits (77), Expect = 0.020 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 295 ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 IS+GTPP F V+ DTGS +W C Sbjct: 95 ISLGTPPLDFPVIVDTGSNLIWAQCAPC 122 >03_02_0806 + 11391880-11391916,11392247-11393634 Length = 474 Score = 35.1 bits (77), Expect = 0.020 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 274 DAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 D +Y ++IGTPPQ +++ DTGS W C Sbjct: 108 DTEYLVHMAIGTPPQPVQLILDTGSDLTWTQCAPC 142 >06_03_1412 + 29993566-29993873,29993960-29994583,29994665-29994800, 29995108-29995196,29995299-29995413,29995565-29995628, 29995711-29995782,29995906-29996153 Length = 551 Score = 34.7 bits (76), Expect = 0.027 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVP--SKKC 378 +Y +++GTP +F V DTGS WVP K+C Sbjct: 105 HYAEVAVGTPNTTFLVALDTGSDLFWVPCDCKQC 138 >03_02_0809 + 11419318-11420493 Length = 391 Score = 34.3 bits (75), Expect = 0.035 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 247 SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 22 SPGAYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 66 >01_06_0258 + 27950196-27950749,27953670-27954570 Length = 484 Score = 34.3 bits (75), Expect = 0.035 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCH 381 QY+ +GTP Q F +V DTGS WV KCH Sbjct: 86 QYFVRFRVGTPAQPFLLVADTGSDLTWV---KCH 116 >01_01_0555 + 4080316-4081680 Length = 454 Score = 34.3 bits (75), Expect = 0.035 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKK 375 +Y +++G+PP+S + DTGS +WV KK Sbjct: 100 EYLMTVNLGSPPRSMLAIADTGSDLVWVKCKK 131 >09_04_0355 + 16922863-16924224 Length = 453 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 274 DAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 D +Y +++GTPPQ + DTGS +W C Sbjct: 95 DLEYVLDLAVGTPPQPITALLDTGSDLIWTQCDTC 129 >09_04_0353 + 16915618-16916934 Length = 438 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 259 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 L + + +Y + IG+PP+ F + DTGS +W C Sbjct: 77 LLRFSEGEYLMDVGIGSPPRYFSAMIDTGSDLIWTQCAPC 116 >04_03_0432 - 15861997-15862096,15862449-15862519,15862612-15862774, 15865311-15865535,15866156-15866403,15866489-15866618, 15866716-15866975 Length = 398 Score = 33.9 bits (74), Expect = 0.047 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 YY I IGTP + + V DTGS LWV C Sbjct: 89 YYTEIGIGTPTKRYYVQVDTGSDILWVNCISC 120 >03_02_0807 + 11398845-11399999 Length = 384 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y ++IGTPPQ ++ DTGS +W + C Sbjct: 34 EYLLHLAIGTPPQPVQLTLDTGSVLVWTQCQPC 66 >01_06_0905 + 32880368-32880633,32882439-32882568,32882704-32882894, 32883625-32883852,32884062-32884224,32884343-32884416, 32884484-32884601,32884722-32884788,32885152-32885223, 32885350-32885513 Length = 490 Score = 33.9 bits (74), Expect = 0.047 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y+ + +G+PP+ + V DTGS LWV C Sbjct: 91 YFTRVKLGSPPKEYFVQIDTGSDILWVACSPC 122 >01_06_0523 - 30009191-30010531 Length = 446 Score = 33.9 bits (74), Expect = 0.047 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +1 Query: 232 DVTGPSPEPLSN---YLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 D TG P+ + + +Y+ ++ +GTP +V DTGS +W+ C Sbjct: 66 DATGRLHSPVFSGIPFESGEYFALVGVGTPSTKAMLVIDTGSDLVWLQCSPC 117 >05_04_0147 - 18419864-18421297 Length = 477 Score = 33.5 bits (73), Expect = 0.062 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 244 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 PS P + Y + +GTPPQ FD S +WVP ++C Sbjct: 76 PSQAPATT--GGTYLITVGVGTPPQYVYGAFDISSQFVWVPCEEC 118 >02_05_0626 - 30456714-30456829,30456951-30457023,30457136-30457250, 30457368-30457450,30457532-30457685,30457859-30458095, 30458212-30458435,30458657-30458774,30459286-30459614 Length = 482 Score = 32.7 bits (71), Expect = 0.11 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 274 DAQYYGVISIGTPPQSFKVVFDTGSCNLWV 363 D QYY I +G PP+ + + DTGS W+ Sbjct: 109 DGQYYTSIFVGNPPRPYFLDVDTGSDLTWI 138 >07_03_0704 + 20831071-20832381 Length = 436 Score = 32.3 bits (70), Expect = 0.14 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 295 ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 IS+GTP +F VV DTGS +W C Sbjct: 90 ISVGTPLLTFSVVADTGSDLIWTQCAPC 117 >05_04_0099 - 17991569-17993014 Length = 481 Score = 32.3 bits (70), Expect = 0.14 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 QY IG PPQ + V DTGS +W C Sbjct: 77 QYIASYGIGDPPQPAEAVVDTGSDLVWTQCSTC 109 >04_04_0040 + 22322839-22324173 Length = 444 Score = 32.3 bits (70), Expect = 0.14 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 295 ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +SIGTP ++ + DTGS +W K C Sbjct: 99 VSIGTPALAYSAIVDTGSDLVWTQCKPC 126 >04_03_0428 - 15820169-15820236,15820296-15820367,15820450-15820519, 15824222-15824312,15825023-15825093,15825176-15825341, 15826169-15826393,15829075-15829307,15829464-15829618, 15829636-15829855 Length = 456 Score = 32.3 bits (70), Expect = 0.14 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >04_03_0418 - 15686775-15686842,15686902-15686973,15687056-15687125, 15690828-15690918,15691629-15691699,15691782-15691947, 15692775-15692999,15695681-15695913,15696070-15696224, 15696242-15696461 Length = 456 Score = 32.3 bits (70), Expect = 0.14 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >02_03_0194 - 16215032-16215177,16215322-16215393,16215518-16215593, 16215984-16216074,16216188-16216258,16216344-16216506, 16218841-16219065,16219206-16219507,16219551-16219680, 16219783-16220045 Length = 512 Score = 32.3 bits (70), Expect = 0.14 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y+ I IGTP + + V DTGS LWV C Sbjct: 90 YFTRIGIGTPAKRYYVQVDTGSDILWVNCVSC 121 >02_02_0636 + 12463660-12465204 Length = 514 Score = 32.3 bits (70), Expect = 0.14 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y + +GTPP+ F+++ DTGS W+ C Sbjct: 151 EYLVDLYVGTPPRRFQMIMDTGSDLNWLQCAPC 183 >06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253, 8968352-8968588,8969122-8969275,8969356-8969438, 8969573-8969687,8969837-8969909,8970005-8970147 Length = 538 Score = 31.9 bits (69), Expect = 0.19 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 274 DAQYYGVISIGTPPQSFKVVFDTGSCNLWV 363 D QYY + IG PP+ + + DTGS W+ Sbjct: 156 DGQYYTSMYIGNPPRPYFLDVDTGSDLTWI 185 >05_07_0313 - 29159638-29161065 Length = 475 Score = 31.9 bits (69), Expect = 0.19 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCHY 384 +Y+ + +GTP + +V DTGS +W+ C + Sbjct: 121 EYFAQVGVGTPATTALMVLDTGSDVVWLQCAPCRH 155 >01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 Length = 492 Score = 31.9 bits (69), Expect = 0.19 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 250 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 P L + LD Y + + +G+P + +VV DTGS WV + C Sbjct: 136 PTTLGSSLDTLEYVISVGLGSPAVTQRVVIDTGSDVSWVQCEPC 179 >06_01_0746 + 5580755-5582119 Length = 454 Score = 31.5 bits (68), Expect = 0.25 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y +S+GTPP+ + DTGS +W C Sbjct: 89 EYLMHVSVGTPPRPVALTLDTGSDLVWTQCAPC 121 >01_01_0261 + 2119519-2121033 Length = 504 Score = 31.5 bits (68), Expect = 0.25 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y+ + +G+P + +V DTGS WV + C Sbjct: 166 EYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPC 198 >07_03_0710 - 20873420-20874745 Length = 441 Score = 31.1 bits (67), Expect = 0.33 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +1 Query: 277 AQYYGVISIGTPPQSFKVVFDTGSCNLW----VPSKKC 378 A Y I+IGTPP V DTGS +W P ++C Sbjct: 90 ATYLVDIAIGTPPLPLTAVLDTGSDLIWTQCDAPCRRC 127 >05_07_0071 - 27481876-27482737,27484328-27484950 Length = 494 Score = 31.1 bits (67), Expect = 0.33 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWV 363 QY+ +GTP Q F ++ DTGS WV Sbjct: 109 QYFVRFRVGTPAQPFVLIADTGSDLTWV 136 >04_04_1586 - 34621945-34623366 Length = 473 Score = 31.1 bits (67), Expect = 0.33 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y+ + +G+PP +V D+GS +WV + C Sbjct: 129 EYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPC 161 >04_04_0042 + 22328464-22329858 Length = 464 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y + IGTPP F DT S +W + C Sbjct: 88 EYLVKLGIGTPPYKFTAAIDTASDLIWTQCQPC 120 >02_05_0552 - 29911280-29912541,29912633-29912762 Length = 463 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 235 VTGPSPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 V+ P L + LD Y + + +GTP + V DTGS WV C Sbjct: 110 VSSSVPTKLGSSLDTLEYVISVGLGTPAVTQTVTIDTGSDVSWVQCNPC 158 >12_02_0913 + 24246217-24247557 Length = 446 Score = 30.7 bits (66), Expect = 0.44 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 QY IG PPQ + + DTGS +W C Sbjct: 89 QYVAEYLIGDPPQRAEALIDTGSDLVWTQCSTC 121 >08_02_0960 + 23058393-23059739 Length = 448 Score = 30.7 bits (66), Expect = 0.44 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y ++IGTPP + + DTGS +W C Sbjct: 91 EYLMDLAIGTPPLRYTAMVDTGSDLIWTQCAPC 123 >07_03_1115 - 24076506-24076677,24077169-24077266,24077622-24077743, 24079059-24079235,24079809-24079897,24079919-24079965, 24080423-24080519,24080600-24080682,24080716-24080796, 24081043-24081199,24081323-24081750,24081985-24082014, 24083180-24083300,24083432-24083697 Length = 655 Score = 30.7 bits (66), Expect = 0.44 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 283 YYGV-ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 YY + IGTP Q F ++ D+GS +VP C Sbjct: 90 YYTTRLYIGTPSQEFALIVDSGSTVTYVPCATC 122 >02_05_0551 + 29907768-29907909,29907995-29909280 Length = 475 Score = 30.7 bits (66), Expect = 0.44 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 QY +S+GTP + + DTGS WV K C Sbjct: 141 QYVVTVSLGTPAVAQTLEVDTGSDVSWVQCKPC 173 >04_03_0316 + 14261942-14262506,14262710-14263134 Length = 329 Score = 30.3 bits (65), Expect = 0.58 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y ++ GTP Q ++ DTGS W K+C Sbjct: 43 EYLVHLAAGTPRQEVQLTLDTGSDIAWTQCKRC 75 >04_01_0509 + 6668208-6668653,6669776-6669779 Length = 149 Score = 30.3 bits (65), Expect = 0.58 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 +Y+ IG PPQ + + DTGS +W C Sbjct: 80 EYFTEYLIGDPPQHAEAIVDTGSNLVWTQCTDC 112 >03_02_0519 + 9066918-9068261 Length = 447 Score = 30.3 bits (65), Expect = 0.58 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 295 ISIGTPPQSFKVVFDTGSCNLWV 363 +++GTPPQ+ +V DTGS W+ Sbjct: 59 VAVGTPPQNVTMVLDTGSELSWL 81 >01_06_1318 - 36261483-36262811 Length = 442 Score = 30.3 bits (65), Expect = 0.58 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +1 Query: 217 LRLKYDVTGPSPEPLSN---YLDAQYYGVISIGTPPQSFKVVFDTGSCNLWV 363 LR + G P P S + + +++GTPPQ+ +V DTGS W+ Sbjct: 41 LRARQVPAGALPRPASKLRFHHNVSLTVSLAVGTPPQNVTMVLDTGSELSWL 92 >12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896, 3932992-3933225,3933659-3933797,3933878-3934096, 3934148-3934220,3934319-3934428 Length = 431 Score = 29.9 bits (64), Expect = 0.76 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 268 YLDAQYYGVISIGTPPQSFKVVFDTGSCNLWV 363 Y YY +SIG PP+ + + DTGS W+ Sbjct: 53 YPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWL 84 >01_05_0596 + 23511148-23512650 Length = 500 Score = 29.9 bits (64), Expect = 0.76 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +1 Query: 280 QYYGVISIGTPPQSFKVVFDTGSCNLWV---PSKKCH 381 +Y+ I +GTP +V DTGS +W+ P ++C+ Sbjct: 146 EYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCY 182 >10_08_0774 + 20478203-20479393 Length = 396 Score = 29.5 bits (63), Expect = 1.0 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 3/86 (3%) Frame = +1 Query: 112 LALIASSVMALYRVPLHRMKTARTHFHEVGTELELLRLKYDVTGPSPEPLS---NYLDAQ 282 +A + S+++ + +PL T HE+ LEL D T P ++ ++ A Sbjct: 1 MASLVSTLLLMCLIPL-------TRAHELRRGLELAD---DATTARPGGVTVPVHFSQAF 50 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLW 360 Y ++IGTPPQ + D G +W Sbjct: 51 YVVNLTIGTPPQPVSAIIDIGGELVW 76 >01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 Length = 508 Score = 29.5 bits (63), Expect = 1.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +1 Query: 241 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 G S +P +N Y S+GTPPQ V D S +W+ C Sbjct: 85 GQSQDPATN--TGMYVLSFSVGTPPQVVTGVLDITSDFVWMQCSAC 128 >10_08_0769 + 20452130-20453314 Length = 394 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >10_08_0766 + 20437772-20438956 Length = 394 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >09_06_0239 - 21794691-21795986 Length = 431 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 295 ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 + IGTP + +VFDT S LW + C Sbjct: 92 LGIGTPAMNVTLVFDTTSDLLWTQCQPC 119 >06_01_0772 + 5770502-5770619,5771035-5772335 Length = 472 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 262 SNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 S+ D + +S+G PP V DTGS WV + C Sbjct: 107 SSINDFLFLMAVSLGKPPVVNLVAIDTGSTLSWVQCQPC 145 >10_01_0182 - 2052037-2052044,2053163-2053748,2055337-2055396 Length = 217 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -2 Query: 369 GRHPEVAGSGVEYHLERLRRRADTDHSVVLSIKII 265 G PE AG VE H +RLR+R D V +I ++ Sbjct: 91 GELPEAAGQWVEAH-QRLRQRCSDDTHQVTAIVVV 124 >03_02_0810 + 11429776-11429985,11430003-11430935 Length = 380 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 277 AQYYGVISIGTPPQSFKVVFDTGS 348 ++Y ++IGTPPQ ++ DTGS Sbjct: 34 SEYLVHLTIGTPPQPVQLTLDTGS 57 >11_01_0539 + 4268326-4268450,4268586-4268751 Length = 96 Score = 28.3 bits (60), Expect = 2.3 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +1 Query: 268 YLDAQYYGVISIGTPPQSFKVVFDTGSCNLWV----PSKKCH 381 Y +++ ++IG P + + + DTGS WV P + CH Sbjct: 39 YPSGRFFVTMNIGVPEKPYFLDIDTGSDLTWVECDAPCQSCH 80 >10_08_0770 + 20459888-20461036 Length = 382 Score = 28.3 bits (60), Expect = 2.3 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 280 QYYGVIS--IGTPPQSFKVVFDTGSCNLWVPSKKC 378 + Y V S IGTPPQ D G +W +C Sbjct: 21 ELYNVASFTIGTPPQPASAFIDVGGLLVWTQCSQC 55 >08_01_0711 - 6275052-6276401 Length = 449 Score = 28.3 bits (60), Expect = 2.3 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 Query: 256 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 P Y D Y + IG Q ++ DTGS +W +C Sbjct: 73 PFRIYEDVVYLAEMEIGERQQKQYLLIDTGSSLVWTQCDEC 113 >02_05_0554 + 29929860-29929959,29932944-29934220 Length = 458 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y + +GTP + +V DTGS W+ C Sbjct: 122 YVTRMGLGTPATQYVMVVDTGSSLTWLQCSPC 153 >10_08_0773 + 20474642-20475835 Length = 397 Score = 27.5 bits (58), Expect = 4.1 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 220 RLKYDVTGPSPEPLSNYLDAQYYGV--ISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 RL D T + + Y V +IGTPPQ + D +W +C Sbjct: 20 RLLADATPAGGSAVPIHWSRHLYNVANFTIGTPPQPASAIIDVAGELVWTQCSRC 74 >10_08_0772 + 20471748-20473004 Length = 418 Score = 27.5 bits (58), Expect = 4.1 Identities = 20/75 (26%), Positives = 28/75 (37%), Gaps = 5/75 (6%) Frame = +1 Query: 169 KTARTHFHEVGTELELL---RLKYDVTGPSPEPLSNYLDAQYYGV--ISIGTPPQSFKVV 333 +TA H++ LE RL D T + + Y V +IGTPPQ + Sbjct: 24 RTAAFRAHDLRRGLEQAMRGRLLADATPAGGSAVPIHWSRHLYNVANFTIGTPPQPASAI 83 Query: 334 FDTGSCNLWVPSKKC 378 D +W C Sbjct: 84 IDVAGELVWTQCSMC 98 >01_07_0213 - 42028941-42029055,42029444-42029480,42029876-42030244, 42030332-42031201,42051574-42052891 Length = 902 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +1 Query: 283 YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 Y +GTP Q+ V D + WVP C Sbjct: 102 YIARAGLGTPAQTLLVAIDPSNDAAWVPCSAC 133 >10_08_0775 + 20484776-20486035 Length = 419 Score = 27.1 bits (57), Expect = 5.4 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 241 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 G + PL ++ A Y +IGTPPQ+ + D +W C Sbjct: 49 GGAVVPL-HWSGAHYVANFTIGTPPQAVSGIVDLSGELVWTQCAAC 93 >02_02_0026 + 6187860-6187940,6188136-6188207,6188302-6188395, 6188480-6188640,6189053-6189123,6189231-6189312, 6189748-6189849,6189972-6190027,6190278-6190312, 6191495-6191579,6191658-6191717,6191819-6191858, 6192415-6192468 Length = 330 Score = 27.1 bits (57), Expect = 5.4 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = -1 Query: 193 HESGFSQFSYDVMAPYIVPLRSWRSAPKKIKISFPLL---FLEAATRRLCNT 47 H + Q + APY VP + S ++ K S PLL F EA +C T Sbjct: 140 HLAELFQVKCIIAAPYFVPYSAPASFERQFKQSLPLLYKYFQEAPLNMVCWT 191 >10_08_0778 + 20492822-20493920,20494605-20494648 Length = 380 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 268 YLDAQ--YYGVISIGTPPQSFKVVFDTGSCNLWVPSKKC 378 YL +Q Y +IGTPPQ V D +W C Sbjct: 50 YLSSQGLYVANFTIGTPPQPVSAVVDLTGELVWTQCTPC 88 >06_01_0418 - 2979418-2981404,2984505-2986469,2987164-2988053 Length = 1613 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 347 DPVSNTTLNDCGGVPILI 294 D VSN+ L CGG+P+ I Sbjct: 380 DEVSNSILKKCGGLPLAI 397 >04_04_0768 - 27954149-27954911,27954955-27955328 Length = 378 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 220 RLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQ 318 R YD P P+ + Y YY ++ G PPQ Sbjct: 307 RAHYDHDHPPPKTVKGYKFVLYYPDLAGGKPPQ 339 >09_06_0186 + 21427739-21428813,21428894-21428977,21429136-21429254 Length = 425 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 342 GVEYHLERLRRRADTDHSVVLS 277 G HL +RRR +TDHS V S Sbjct: 63 GTNGHLVYVRRRLETDHSKVSS 84 >07_03_1556 + 27692770-27694119 Length = 449 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 301 IGTPPQSFKVVFDTGSCNLWVPSKKC 378 +GTP Q + DT + W+P C Sbjct: 113 LGTPAQQLLLAVDTSNDAAWIPCSGC 138 >04_01_0617 - 8076624-8076971,8077761-8077883,8077965-8078035, 8078108-8078360,8078613-8078768,8078854-8079770, 8079858-8079927,8082310-8082416,8082722-8082755, 8083621-8083940,8084031-8084820,8084890-8085046, 8085647-8086068 Length = 1255 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/49 (24%), Positives = 21/49 (42%) Frame = +1 Query: 238 TGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSCNLWVPSKKCHY 384 T P+P P ++ D + S G + + CN+WV ++ Y Sbjct: 232 TTPAPAPADDWGDGSWTVDCSCGITYDDGEEMVSCDECNVWVHTRCARY 280 >02_05_1269 + 35352825-35352888,35353645-35353968,35355062-35355183, 35355361-35355482,35355651-35355755,35356402-35356765, 35357181-35357321,35357619-35359109 Length = 910 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 366 RHPEVAGSGVEYHLERLRR--RADTDHSVVLSIKI 268 R P++AG G Y E +R R+ D S + ++K+ Sbjct: 839 RDPQIAGDGFSYEAEAIREWLRSGRDTSPMTNLKL 873 >02_05_0367 - 28331479-28332358,28332432-28332988,28333454-28333671, 28333748-28333831,28334199-28334373,28334572-28334574 Length = 638 Score = 26.2 bits (55), Expect = 9.4 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = +3 Query: 51 LQSRLVAASKNNNGKDIFIFFGADRQLRNGTI*GAITSYENCENPLS*G 197 L+ R + S N G+ + F A R + G GA+T YE+ E S G Sbjct: 288 LRYRYIRPSGNPVGRIFQVAFAACRNWKAGESPGAVTLYESDEKADSGG 336 >01_03_0113 - 12647599-12648052,12648078-12648319 Length = 231 Score = 26.2 bits (55), Expect = 9.4 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = -1 Query: 220 STAPVQ---CQPHESGFSQFSYDVMAPYIVPLRSWRS 119 S APV C P + F + SY V AP+ L+ WRS Sbjct: 83 SAAPVVNCICVPLKHSFDRASYIVRAPWGDILQVWRS 119 >01_01_0452 - 3357687-3358332,3358779-3359641 Length = 502 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -1 Query: 241 QSHRILISTAPVQCQPHESGFSQFSYDVMAPYIVPLRSWRSAPKKIK 101 +S + ++ + V+ P + F FS + A Y VP+ W S P +K Sbjct: 39 ESSQPSVNLSVVKTPPTQPSFVTFS--IFANYRVPISLWTSKPVHLK 83 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,332,687 Number of Sequences: 37544 Number of extensions: 230797 Number of successful extensions: 630 Number of sequences better than 10.0: 85 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -