BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31703 (400 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 1.5 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 2.6 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 21 5.9 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 21 5.9 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 21 5.9 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 1.5 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = -1 Query: 241 AVPIPPNEVAMPSRPFSILSSSIPWSAKLEISFTCPALSLPKLSSAES 98 A P PP E A P + + S P S E C L + +S ES Sbjct: 43 ASPAPPEEEAASPTPGDVPTPSSPRSIS-EDPLNCRDLPNSRCNSRES 89 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.8 bits (44), Expect = 2.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 169 MV*TKIKSKRALKALPLHWAVSALPLVVPSPQ 264 +V T++ + LP A S LPL+VP PQ Sbjct: 174 LVPTRLANGDIALVLPTQGA-SPLPLLVPIPQ 204 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 20.6 bits (41), Expect = 5.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -2 Query: 66 PNPGVMVSKSRNPW 25 PN ++V+ S PW Sbjct: 61 PNENLVVTSSNRPW 74 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 20.6 bits (41), Expect = 5.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -2 Query: 66 PNPGVMVSKSRNPW 25 PN ++V+ S PW Sbjct: 62 PNENLVVTSSNRPW 75 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 20.6 bits (41), Expect = 5.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -2 Query: 66 PNPGVMVSKSRNPW 25 PN ++V+ S PW Sbjct: 62 PNENLVVTSSNRPW 75 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,833 Number of Sequences: 336 Number of extensions: 1800 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -