BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31703 (400 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 6.9 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 20 9.1 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 6.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 106 AESPKLPNPGVVVSKSRSHGVQIPESMVSQXRS 8 A KL +PG + S HG+Q + Q S Sbjct: 1022 ASQIKLVSPGQIKSLLTGHGLQGQTIFIKQSPS 1054 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.2 bits (40), Expect = 9.1 Identities = 7/23 (30%), Positives = 10/23 (43%) Frame = +1 Query: 4 HDSGFGTPWIPGFGHHDSGIWTP 72 HD +G P + G G+ P Sbjct: 204 HDDHYGVPTLEELGFDTEGLLPP 226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,544 Number of Sequences: 438 Number of extensions: 2499 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -