BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31700 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 25 0.53 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 25 0.53 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 25 0.53 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 25 0.53 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.1 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 22 2.8 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 4.9 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 8.6 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 24.6 bits (51), Expect = 0.53 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 311 FFLHGLSVLFNDELSGQSYEL 249 +FL G L NDELS S E+ Sbjct: 130 YFLLGFRYLVNDELSAHSKEI 150 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.6 bits (51), Expect = 0.53 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 311 FFLHGLSVLFNDELSGQSYEL 249 +FL G L NDELS S E+ Sbjct: 444 YFLLGFRYLVNDELSAHSKEI 464 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.6 bits (51), Expect = 0.53 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -2 Query: 341 LVVQSERFPEFFLHGLSVLFNDELSGQSYELGEFQTTRFVGVDLLNKFLEDFL 183 LV+ SE+ F L ++FN LS ++ E+ +RF ++ +FL +L Sbjct: 154 LVIVSEQEWSFSTGLLVMIFNSALSYKASEIVVMLRSRFAILNKQIRFLNQYL 206 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 24.6 bits (51), Expect = 0.53 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -2 Query: 341 LVVQSERFPEFFLHGLSVLFNDELSGQSYELGEFQTTRFVGVDLLNKFLEDFL 183 LV+ SE+ F L ++FN LS ++ E+ +RF ++ +FL +L Sbjct: 172 LVIVSEQEWSFSTGLLVMIFNSALSYKASEIVVMLRSRFAILNKQIRFLNQYL 224 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 311 FFLHGLSVLFNDELSGQSYEL 249 +FL G + NDELS S E+ Sbjct: 677 YFLLGFRLQANDELSAHSKEI 697 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 2.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 311 FFLHGLSVLFNDELSGQSYEL 249 +FL G + NDELS S E+ Sbjct: 677 YFLLGFRLQANDELSAHSKEI 697 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.2 bits (45), Expect = 2.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 176 WLPHHSQDISHEVTGDT 126 W+PH + S EV G+T Sbjct: 493 WVPHSCKLTSKEVPGET 509 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 121 ERLWSKPSKALRRT 80 ERLW+ PS +++T Sbjct: 546 ERLWTNPSDYVKQT 559 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 20.6 bits (41), Expect = 8.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +1 Query: 298 PCRKNSGK 321 PCRKN+G+ Sbjct: 96 PCRKNTGR 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,439 Number of Sequences: 336 Number of extensions: 1671 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -