BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31695 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 24 2.6 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.1 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 121 ITTVPCQRGRSSSRGGVPAGTS 186 +T C GRS+S VP GTS Sbjct: 84 LTAAHCTAGRSTSSLTVPLGTS 105 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 22.6 bits (46), Expect = 8.1 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +1 Query: 67 PTPPKVSRTLERSK-----LKHNITTVPCQRGRS 153 P PP RTL+R K + T CQR RS Sbjct: 402 PNPPWADRTLKRLKRVKRAAYRHYQTRRCQRSRS 435 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,557 Number of Sequences: 2352 Number of extensions: 8122 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -