BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31691 (334 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0285 + 32848085-32848988,32849057-32849245,32850136-328503... 27 3.7 04_04_0998 - 29996117-29996242,29996345-29996486,29996613-299968... 27 4.9 >03_06_0285 + 32848085-32848988,32849057-32849245,32850136-32850311, 32850569-32851141 Length = 613 Score = 27.1 bits (57), Expect = 3.7 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -1 Query: 244 YRIQCRSHRRXXGLHGXRCRHQSC-RECNGQSCRGW 140 Y C++H+ GLHG QSC +C G + W Sbjct: 317 YSSHCKAHKICSGLHG--IADQSCSADCCGTASGAW 350 >04_04_0998 - 29996117-29996242,29996345-29996486,29996613-29996812, 29997112-29997497,29997769-29998318,29998949-29999296 Length = 583 Score = 26.6 bits (56), Expect = 4.9 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = -1 Query: 265 FLRDLQQYRIQCRSHRRXXGLHGXRCRHQSCRECNGQSCR 146 FL DL I C S + C+H C +C G CR Sbjct: 284 FLEDLHMCMI-CLSQSKGSNFIRLPCQHLFCVKCLGTLCR 322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.136 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,164,337 Number of Sequences: 37544 Number of extensions: 107765 Number of successful extensions: 224 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 459426840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -