Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV31684
         (500 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy...    25   8.4  

>SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 4924

 Score = 24.6 bits (51), Expect = 8.4
 Identities = 17/62 (27%), Positives = 26/62 (41%)
 Frame = -1

Query: 284 ISFLLNTNFQTKYWCL*SGNLIIILVIHTPCWRLRNLQFSFKQSFHIKQLTVGSLDIVQS 105
           I F  +    T +       L++  V+H  C +  N   S  +   I  L + SLDIV  
Sbjct: 699 IQFSASDKHSTDFSSFNQSELLVANVLHEICEKRFNSVVSISRFSSIFDLGLDSLDIVYF 758

Query: 104 VQ 99
           V+
Sbjct: 759 VR 760


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,864,694
Number of Sequences: 5004
Number of extensions: 35522
Number of successful extensions: 71
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 70
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 71
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 198176188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)