BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31684 (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 1.4 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 2.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 3.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 3.1 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.5 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.4 bits (48), Expect = 1.4 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -1 Query: 296 IRNIISFLLNTNFQTKY 246 + NI ++++NTN+ +KY Sbjct: 194 MNNIETYIVNTNYSSKY 210 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/51 (19%), Positives = 27/51 (52%) Frame = -1 Query: 224 LIIILVIHTPCWRLRNLQFSFKQSFHIKQLTVGSLDIVQSVQMEQYFQITY 72 ++++L+IH R++++ ++K + LDI++++ E Q + Sbjct: 154 IVMVLIIHPGDPRIKSVVTAYKADYTKISTLDAILDIIRNMVPENLVQACF 204 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 223 KLPDYKHQYLV*KLVFNKKEMIF 291 ++ DY H Y + + +NK E+I+ Sbjct: 424 RIIDYYHSYKMHQKPYNKDEIIY 446 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 3.1 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 223 KLPDYKHQYLV*KLVFNKKEMIF 291 ++ DY H Y + + +NK E+I+ Sbjct: 424 RIIDYYHSYKMHQKPYNKDEIIY 446 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 365 YSTLQVIKNQNNLSMK 412 +S VI N+NN SMK Sbjct: 483 FSYTIVINNRNNTSMK 498 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,352 Number of Sequences: 438 Number of extensions: 2854 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -