BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31680 (454 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0545 - 4756266-4757510 28 4.0 03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711,550... 27 5.3 >05_01_0545 - 4756266-4757510 Length = 414 Score = 27.9 bits (59), Expect = 4.0 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 410 CKPS**YLRWRRQCS*VXRTSPR*CASFQ-QLYVPAP 303 C P+ Y R RQC+ P CA+FQ + +VP+P Sbjct: 346 CLPNRPYQRTPRQCAAFYAAPPVDCAAFQCKPFVPSP 382 >03_02_0080 + 5498638-5498699,5499121-5499190,5499551-5500711, 5500940-5501029,5501147-5501464 Length = 566 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 312 NVKLLKGGASSRRGAVNLRTLTTPT 386 N K KGGAS+ + A + RT T PT Sbjct: 504 NGKAKKGGASTPKKAAHRRTTTVPT 528 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,417,134 Number of Sequences: 37544 Number of extensions: 110181 Number of successful extensions: 269 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 269 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -