BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31677 (400 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 3.1 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 3.1 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 3.1 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 22 7.2 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 3.1 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -2 Query: 381 ALLTLAILWNRILPRSGLGRVSPXM-TSSSNMSFXPLRKSSSMFSMPVPAFLR 226 A L +I + ++L + G+ ++ + +NM+F + ++FS +P FLR Sbjct: 451 ATLIGSIYFGQVLDQDGVMNINGSLFLFLTNMTFQNVFAVINVFSAELPVFLR 503 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 3.1 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -2 Query: 381 ALLTLAILWNRILPRSGLGRVSPXM-TSSSNMSFXPLRKSSSMFSMPVPAFLR 226 A L +I + ++L + G+ ++ + +NM+F + ++FS +P FLR Sbjct: 451 ATLIGSIYFGQVLDQDGVMNINGSLFLFLTNMTFQNVFAVINVFSAELPVFLR 503 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.4 bits (48), Expect = 3.1 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -2 Query: 381 ALLTLAILWNRILPRSGLGRVSPXM-TSSSNMSFXPLRKSSSMFSMPVPAFLR 226 A L +I + ++L + G+ ++ + +NM+F + ++FS +P FLR Sbjct: 429 ATLIGSIYFGQVLDQDGVMNINGSLFLFLTNMTFQNVFAVINVFSAELPVFLR 481 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.2 bits (45), Expect = 7.2 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +1 Query: 205 HSXVQQSPQKSWHRHREHRGRLPQWXEA 288 H Q Q+ +HR R P+W A Sbjct: 220 HQHQLQPQQRRFHRQSPAHRRKPRWRRA 247 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 379,255 Number of Sequences: 2352 Number of extensions: 7453 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -