BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31676 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 27 0.075 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 26 0.17 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 25 0.40 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 0.92 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 4.9 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 8.6 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 27.5 bits (58), Expect = 0.075 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +2 Query: 266 YPYSKSIYDDPIAAAERITVPGYRYLPVHREIYGYSPRPIYAHNYPRSLDY 418 +PY+ ++Y DP AA I LP+H P P+Y H+Y R Y Sbjct: 135 WPYA-AVYTDPAFAAS-IFHAAATSLPLHYP----PPPPVYTHHYARYHPY 179 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 26.2 bits (55), Expect = 0.17 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 28 PRHHTTLFNYDRYLTEYEHDID 93 PRH + L N + +T+YE D+D Sbjct: 197 PRHASDLDNCNHLMTKYEPDLD 218 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 25.0 bits (52), Expect = 0.40 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = +2 Query: 197 EDIRAEERYRPTRRSVF--PELLSTYPYSKSIYDDPIAAAERITVPGYRYLPVHREIYGY 370 E+IR + R PT + P + +T P ++D +A ER+ +PG + R + Y Sbjct: 22 ENIR-DRRVLPTVEPGYLRPLIPATAPQKPDKWEDVMADIERVIMPGVTHWHSPR-FHAY 79 Query: 371 SPRPIYAHNYP 403 P A++YP Sbjct: 80 FPT---ANSYP 87 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.8 bits (49), Expect = 0.92 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +1 Query: 301 RCR*EDYGTRLPLPACPSRDLRLLPAPYLCPQLPSLSRLLQANPKSL 441 RC + L P CPS + L L +P+LS + A P +L Sbjct: 83 RCNSRESSDSLVQPRCPSGESMLSERAALLRGVPTLSPVGVALPPTL 129 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 4.9 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -2 Query: 200 LPNLLENARRTAKIWLSSTASRFCQSCLNVF*TFWRSMSCSYS 72 LP EN I +S+ + S N F TFW+ S Sbjct: 417 LPRYTENQLNYPGITVSNIEVQSQGSSKNTFNTFWQQSDVDLS 459 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +1 Query: 208 SRGKVQANTPQRFSRTPVDLP 270 +R + +A+ SRTP+++P Sbjct: 160 ARAREEAHIVPEGSRTPIEIP 180 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,395 Number of Sequences: 336 Number of extensions: 2518 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -