BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31676 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287... 29 2.2 02_04_0271 + 21445113-21445865,21446727-21446788,21446927-214470... 28 3.9 04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305,962... 28 5.1 06_01_1181 + 10148653-10149405 27 6.8 10_08_0739 + 20217842-20218852 27 8.9 06_01_0875 + 6707483-6709394,6709750-6709829,6710077-6710174,671... 27 8.9 02_03_0138 - 15629421-15629440,15629521-15629752,15630115-156303... 27 8.9 >05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613, 2879715-2879973,2880060-2880346,2880423-2880758, 2880862-2881003,2881077-2881297,2881379-2881540, 2881617-2881775,2881860-2882159,2882834-2883097, 2883133-2883243,2883902-2883988 Length = 1871 Score = 29.1 bits (62), Expect = 2.2 Identities = 22/70 (31%), Positives = 28/70 (40%) Frame = +2 Query: 221 YRPTRRSVFPELLSTYPYSKSIYDDPIAAAERITVPGYRYLPVHREIYGYSPRPIYAHNY 400 Y PT + P S P S S P + + T P Y Y P YSP ++NY Sbjct: 1683 YNPTSSAYSPTSPSYNPTSPSYSYSPTSPSYSPTSPSYSYSPTSP---SYSPTS-PSYNY 1738 Query: 401 PRSLDYYRPT 430 + Y PT Sbjct: 1739 SPTSPSYSPT 1748 >02_04_0271 + 21445113-21445865,21446727-21446788,21446927-21447027, 21447165-21447248,21448054-21448058,21448193-21448267, 21448339-21448416,21448896-21448952,21449351-21449421, 21449529-21449628,21449758-21449862,21450004-21450066, 21450144-21450266,21450371-21450514,21450598-21450672 Length = 631 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 3 GPTLDVGSSTTPHYPI*LRPLFNRIRARHRPPKCSKHI 116 GPT SS+ H P RIRA P+CSKH+ Sbjct: 47 GPTSSSSSSSDEHEP-------RRIRAEAHCPRCSKHM 77 >04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305, 9625520-9626032,9626801-9629153 Length = 1342 Score = 27.9 bits (59), Expect = 5.1 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +1 Query: 184 SKRFGRHQSRGKVQANTPQR-FSRTPVDLPLLQV-DLRRPYRCR 309 SKR +HQ+R T +R F R PV LP ++ +R P + + Sbjct: 759 SKRIYKHQNRNNNNIRTKKRYFLRRPVRLPFKEILGIRIPVKVK 802 >06_01_1181 + 10148653-10149405 Length = 250 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +2 Query: 332 YRYLPVHREIYGYSPRPIYAHNYPRSLDYYRPTRKV 439 +RY+ VH +Y P+ + YP ++ P V Sbjct: 155 FRYVQVHHPVYAAPGEPVQGYGYPVAMSSALPAPHV 190 >10_08_0739 + 20217842-20218852 Length = 336 Score = 27.1 bits (57), Expect = 8.9 Identities = 18/59 (30%), Positives = 23/59 (38%) Frame = +1 Query: 235 PQRFSRTPVDLPLLQVDLRRPYRCR*EDYGTRLPLPACPSRDLRLLPAPYLCPQLPSLS 411 P S LP + P+R PLP PS L L+P+ P LP L+ Sbjct: 26 PSLISHLGAGLPAFAAGIHCPHR-------VSFPLPTAPSASLLLMPSWSAHPSLPYLA 77 >06_01_0875 + 6707483-6709394,6709750-6709829,6710077-6710174, 6710704-6710840,6710961-6711301,6711402-6711599 Length = 921 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 178 HEGLPKSGFLRRRLVSANHV*MCFEHFGGLCRARIRLN 65 H L + GF R +VS N + +C+ G +C AR N Sbjct: 227 HNMLKRKGF-ERNVVSWNSMMICYIKAGDVCSARALFN 263 >02_03_0138 - 15629421-15629440,15629521-15629752,15630115-15630348, 15630486-15630709,15631225-15631509,15631549-15631690 Length = 378 Score = 27.1 bits (57), Expect = 8.9 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 134 NETPSKKARFWQSFVRSLKGSEDIRAEER 220 +E +++ WQ+F+ +KG E+ EE+ Sbjct: 135 HELATRQVECWQAFLSPMKGKEEDEGEEK 163 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,305,135 Number of Sequences: 37544 Number of extensions: 292031 Number of successful extensions: 945 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -