BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31676 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 24 3.5 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 4.6 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 4.6 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 23 6.1 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 23 6.1 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 6.1 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 6.1 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 23.8 bits (49), Expect = 3.5 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -1 Query: 141 VSFLPIMSKCVLNIL 97 VS P++S+C+LN++ Sbjct: 24 VSLAPVLSECLLNVI 38 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 4.6 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 258 CRPTLTPSRFTTTLSLPLRGLRYPATVTCLSIARSTATPRALSMPTTT 401 C P + TTTL LR T T +T PTTT Sbjct: 88 CEPQSPGDQTTTTLRPATTTLRPTTTTTDWITTTTTEATTTTRFPTTT 135 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 4.6 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 258 CRPTLTPSRFTTTLSLPLRGLRYPATVTCLSIARSTATPRALSMPTTT 401 C P + TTTL LR T T +T PTTT Sbjct: 88 CEPQSPGDQTTTTLRPATTTLRPTTTTTDWITTTTTEATTTTRFPTTT 135 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 273 TPSRFTTTLSLPLRGLRYPATVTCLSIARSTATPR 377 T R T++L++PL R+ + T + +AR P+ Sbjct: 90 TAGRSTSSLTVPLGTSRHASGGTVVRVARVVQHPK 124 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.0 bits (47), Expect = 6.1 Identities = 17/68 (25%), Positives = 32/68 (47%) Frame = +3 Query: 261 RPTLTPSRFTTTLSLPLRGLRYPATVTCLSIARSTATPRALSMPTTTLALSIITGQPEKF 440 + T P+ T + R AT T ++ RS A S+ + L ++TG+PE Sbjct: 558 KATSPPAVATPPSTSRARTATRTATTTTRAL-RSAKKEPAESLDMDGINLVMVTGEPEDE 616 Query: 441 KGVVQLKN 464 K +++++ Sbjct: 617 KHEIEIEH 624 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 214 LGSDVFRTF*RTHEGLPKSGFLRRRLVSANH 122 L SDV + R + + K+ F +R+V NH Sbjct: 523 LDSDVLIEYVRKRQTIAKTMFQEKRVVIENH 553 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.0 bits (47), Expect = 6.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +3 Query: 267 TLTPSRFTTTLSLPLRGLRYPATVTCLSIARSTATPRALSMPTTTLALS 413 T T + TTT++ P T T ++ ++T T A TTT S Sbjct: 33 TTTVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQTTTTTVAS 81 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,224 Number of Sequences: 2352 Number of extensions: 10994 Number of successful extensions: 43 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -