BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31676 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60930.1 68414.m06858 DNA helicase, putative strong similarit... 30 0.80 At3g54990.1 68416.m06102 AP2 domain-containing transcription fac... 30 1.1 At3g07740.2 68416.m00935 transcriptional adaptor (ADA2a) identic... 29 1.9 At3g07740.1 68416.m00936 transcriptional adaptor (ADA2a) identic... 29 1.9 At5g23910.1 68418.m02808 kinesin motor protein-related 29 2.5 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 2.5 At5g55540.1 68418.m06919 expressed protein 28 3.2 At1g67170.1 68414.m07641 expressed protein similar to enterophil... 28 3.2 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 27 5.7 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 27 7.5 At5g23440.1 68418.m02750 ferredoxin-thioredoxin reductase, putat... 27 9.9 At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 ... 27 9.9 At5g17860.1 68418.m02093 cation exchanger, putative (CAX7) conta... 27 9.9 At5g02950.1 68418.m00238 PWWP domain-containing protein predicte... 27 9.9 >At1g60930.1 68414.m06858 DNA helicase, putative strong similarity to DNA Helicase recQl4B [Arabidopsis thaliana] GI:11121451; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00570: HRDC domain Length = 1024 Score = 30.3 bits (65), Expect = 0.80 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +3 Query: 318 LRYPATVTCLSIARSTATPRALSMPTTTLALSIITGQPEKFKGVV--QLKN 464 +R+P+T+ ++STA P + + TTL ++ Q G++ LKN Sbjct: 928 MRFPSTIKVSKQSKSTANPAKVPLKQTTLPMAKAAPQDSNLSGILLTALKN 978 >At3g54990.1 68416.m06102 AP2 domain-containing transcription factor, putative similar to (SP:P47927) Floral homeotic protein APETALA2, Arabidopsis thaliana, U12546 Length = 247 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 55 YDRYLTEYEH-DIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSRGK 219 YDR ++ D D V + +RHD K + + + + LR S FGR S+ K Sbjct: 161 YDRAAIKFRGLDADINFVVDDYRHDIDKMKNLNKVEFVQTLRRESASFGRGSSKYK 216 >At3g07740.2 68416.m00935 transcriptional adaptor (ADA2a) identical to transcriptional adaptor ADA2a [Arabidopsis thaliana] gi|13591698|gb|AAK31319 Length = 477 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 49 FNYDRYLTEYEHDIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSR 213 +N R E EHD D + + DA E Q L VLR +SKR + R Sbjct: 204 YNLKREEFEIEHDNDAEQLLADMEFKDSDTDA-EREQKLQVLRIYSKRLDERKRR 257 >At3g07740.1 68416.m00936 transcriptional adaptor (ADA2a) identical to transcriptional adaptor ADA2a [Arabidopsis thaliana] gi|13591698|gb|AAK31319 Length = 548 Score = 29.1 bits (62), Expect = 1.9 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 Query: 49 FNYDRYLTEYEHDIDRQNVQNTFRHDWQKRDAVEESQILAVLRAFSKRFGRHQSR 213 +N R E EHD D + + DA E Q L VLR +SKR + R Sbjct: 275 YNLKREEFEIEHDNDAEQLLADMEFKDSDTDA-EREQKLQVLRIYSKRLDERKRR 328 >At5g23910.1 68418.m02808 kinesin motor protein-related Length = 665 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 279 SRFTTTLSLPLRGLRYPATVTCLSIARSTATPRALSMPTTTLAL 410 S+ T L L+G +TCL++ R T R + T T A+ Sbjct: 261 SKLTRMLKDCLKGSNITLLITCLTVLRGNVTERKTKINTATSAI 304 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/67 (29%), Positives = 27/67 (40%) Frame = +2 Query: 239 SVFPELLSTYPYSKSIYDDPIAAAERITVPGYRYLPVHREIYGYSPRPIYAHNYPRSLDY 418 S P L P K IY+ P + P Y ++ SP P Y ++ P Y Sbjct: 131 SSLPPLTYYSPSPKVIYNSPPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPPPPPY 190 Query: 419 YRPTRKV 439 Y P+ KV Sbjct: 191 YSPSPKV 197 Score = 27.5 bits (58), Expect = 5.7 Identities = 19/71 (26%), Positives = 28/71 (39%) Frame = +2 Query: 227 PTRRSVFPELLSTYPYSKSIYDDPIAAAERITVPGYRYLPVHREIYGYSPRPIYAHNYPR 406 P+ + P L P K Y P ++P Y ++ SP P Y ++ P Sbjct: 101 PSVYTFSPPQLYYSPSPKVEYKSPPPPYVYSSLPPLTYYSPSPKVIYNSPPPPYIYSSPP 160 Query: 407 SLDYYRPTRKV 439 YY P+ KV Sbjct: 161 PPPYYSPSPKV 171 >At5g55540.1 68418.m06919 expressed protein Length = 1380 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -1 Query: 252 SGKTLRRVGLYLSSALMSSEPFRE----RTKDCQNLA 154 SGKT+ R G L+ L+S + FRE R D NLA Sbjct: 1057 SGKTVLRAGFDLARNLLSDDDFREVLQRRYHDLHNLA 1093 >At1g67170.1 68414.m07641 expressed protein similar to enterophilin-2L (GI:12718845) [Cavia porcellus]; similar to Hyaluronan mediated motility receptor (Intracellular hyaluronic acid binding protein) (Receptor for hyaluronan-mediated motility) (CD168 antigen) (Swiss-Prot:O75330) [Homo sapiens] Length = 359 Score = 28.3 bits (60), Expect = 3.2 Identities = 19/80 (23%), Positives = 33/80 (41%) Frame = +2 Query: 122 MIGRNETPSKKARFWQSFVRSLKGSEDIRAEERYRPTRRSVFPELLSTYPYSKSIYDDPI 301 ++ R E SK + Q +S + I A R + + +TY Y K Y+D + Sbjct: 150 VVAREELMSKVHQLTQELQKSRSDVQQIPALMSELENLRQEYQQCRATYDYEKKFYNDHL 209 Query: 302 AAAERITVPGYRYLPVHREI 361 E + Y+ + RE+ Sbjct: 210 ---ESLQAMEKNYMTMAREV 226 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 287 YDDPIAAAERITVPGYRYLPVHREIYGYSPRPIYAHNYPRSLDYYRPTRKV 439 Y P + P Y E+ SP P++ +N+P +Y P+ KV Sbjct: 262 YYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPPPFYSPSPKV 312 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 27.1 bits (57), Expect = 7.5 Identities = 18/57 (31%), Positives = 23/57 (40%) Frame = +2 Query: 269 PYSKSIYDDPIAAAERITVPGYRYLPVHREIYGYSPRPIYAHNYPRSLDYYRPTRKV 439 P K Y P + P Y P + Y SP P Y ++ P YY P+ KV Sbjct: 700 PAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYK-SPPPPYVYSSPPPPPYYSPSPKV 755 >At5g23440.1 68418.m02750 ferredoxin-thioredoxin reductase, putative similar to ferredoxin-thioredoxin reductase, variable chain (FTR-V, Ferredoxin- thioredoxin reductase subunit A, FTR-A) [Zea mays] SWISS-PROT:P80680 Length = 182 Score = 26.6 bits (56), Expect = 9.9 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +3 Query: 318 LRYPATVTCLSIARSTATPRALSMPTTTLA-LSIITGQPE 434 +R P++ CLS + +TAT +++ + +A LS+ T Q + Sbjct: 15 IRRPSSHDCLSASATTATATPMALKSCIVAPLSLFTSQSQ 54 >At5g18230.1 68418.m02139 transcription regulator NOT2/NOT3/NOT5 family protein contains Pfam domain PF04153: NOT2 / NOT3 / NOT5 family Length = 843 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 192 VRKTSEPRKGTGQHAAAFFPNSCRPTL 272 V KT P+ G G H+A P RP+L Sbjct: 295 VPKTPPPKNGAGLHSAPSTPAGGRPSL 321 >At5g17860.1 68418.m02093 cation exchanger, putative (CAX7) contains similarity to SWISS-PROT:Q9HC58 NKX3_HUMAN Sodium/potassium/calcium exchanger 3 precursor {Homo sapiens}; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 570 Score = 26.6 bits (56), Expect = 9.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 376 APYLCPQLPSLSRLLQANP 432 A Y CP L SLS++L+ +P Sbjct: 121 ASYFCPSLDSLSKVLKLSP 139 >At5g02950.1 68418.m00238 PWWP domain-containing protein predicted protein, Arabidopsis thaliana Length = 632 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 189 KVRKTSEPRKGTGQHAAAFFPNSCRPTLTPSR 284 K++KT+EP GTG NS PTL P R Sbjct: 394 KLQKTAEPCHGTGVENEM---NSLTPTLKPCR 422 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,433,607 Number of Sequences: 28952 Number of extensions: 219847 Number of successful extensions: 665 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 663 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -