BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31661 (403 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 3.4 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 6.0 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 20 7.9 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.4 bits (43), Expect = 3.4 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +3 Query: 231 NTXTNGANSGP----RRRMSSNALKRSRPSAR 314 +T T N P +RR ++ A KRSR + R Sbjct: 126 STTTQNKNDDPSYWEKRRKNNEAAKRSRDARR 157 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 6.0 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = -3 Query: 278 AHPPPWPAVCAIRXC 234 +HPP W C + C Sbjct: 51 SHPPQWTWQCINQRC 65 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 20.2 bits (40), Expect = 7.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 Query: 272 PPPWPAVCAIRXCIPS 225 PP PAVC + C S Sbjct: 161 PPCDPAVCVLPDCFCS 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,832 Number of Sequences: 336 Number of extensions: 1033 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8646818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -