BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31660 (516 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0273 - 26851077-26851167,26851433-26851869,26852125-268522... 28 3.9 01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346,840... 27 8.9 >05_06_0273 - 26851077-26851167,26851433-26851869,26852125-26852271, 26852352-26854415,26854792-26854908,26855007-26855093, 26855350-26855439,26855523-26855609,26856736-26856810 Length = 1064 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 352 DLGSIHDSVNWLTXTTNCCXAEGKSNYMCXPIDIXQDDPV 471 D+ S+ D W T +EG SNY+C D P+ Sbjct: 230 DIESLGDVYVWGEVWTEVLPSEGSSNYLCSKTDFLIPKPL 269 >01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346, 8405434-8405493,8405721-8406137,8406576-8407100 Length = 761 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 157 PSRGTFHTPVIRLLPEAG 210 PSRG H P++RL P G Sbjct: 34 PSRGVLHAPLLRLWPLGG 51 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,674,448 Number of Sequences: 37544 Number of extensions: 246431 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -