BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV31637 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 4.6 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 8.1 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 23.4 bits (48), Expect = 4.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 250 PLFAPFVDVFLQLFIQVRPLLVLTLDEFWI 161 PL P DVFL F V P + E W+ Sbjct: 12 PLSYPQTDVFLVCFSVVSPSSFENVKEKWV 41 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 462 P*KMPARPDPTSPSKRR 512 P +P RP P S KRR Sbjct: 406 PSTLPTRPSPKSSRKRR 422 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 325,165 Number of Sequences: 2352 Number of extensions: 4177 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -